KEGG   Caenorhabditis elegans (nematode): ATP6Help
Entry
ATP6              CDS       T00019                                 

Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  
F-type H+-transporting ATPase subunit a
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ATP6
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    ATP6
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
MT:2634..3233
Genome map
AA seq 199 aa AA seqDB search
MNQVYFLDIFMFVFVLQFLFYFKESMLNTLVKKFLNSLVGVFSYTNTLPLSSVISIFTFI
VLLTCCFGGYFTYSFCPCGMVEFTFVYAAVAWLSTLLTFISSEKFSVYMSKPGDTYLKTL
SMLLIEIVSEFSRPLALTVRLTVNITVGHLVSMMLYQGLELSMGDQYIWLSILAIMMECF
VFFIQSYIFSRLIFLYLNE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
attaatcaagtttattttttagacatttttatatttgtttttgttttacaatttttgttt
tattttaaagaaagtatattaaatactttagtgaaaaaatttcttaataggttagtagga
gtatttagatatacaaatactttaccattaaggtcagtaatttctatttttacttttatt
gttcttttaacttgttgttttggaggttattttacttactctttttgtccttgtggaatg
gttgaatttacttttgtttatgctgctgtagcgtgattaagtactttgttaacttttatt
tcaagagaaaaattttcagtttatataagaaaaccaggagacacatatttgaaaactctt
agaatgctattaattgaaatcgttagagaattttctcgtccacttgctttaacagtgcgt
ttaacagttaatattactgttggtcatttagttagaataatgctttatcaaggattagaa
ttaagaataggtgatcagtatatttgattatcaattttagccattataatagaatgtttt
gttttcttcattcaaagttatattttctctcgtttaatttttttatatcttaatgagtaa

DBGET integrated database retrieval system