KEGG   Caenorhabditis elegans (nematode): CELE_4R79.1Help
Entry
CELE_4R79.1       CDS       T00019                                 

Gene name
nas-6
Definition
Protein NAS-6, isoform B
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_4R79.1 (nas-6)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_4R79.1 (nas-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(17486982..17487121,17487224..17487344,17487396..17487551,17488079..17488164,17488229..17488268))
Genome map
AA seq 180 aa AA seqDB search
MHSVGFWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDST
AFSRNGRNTIETVENGFTQVIGTAMDLSPLDIVKINKLYSCKTKKKEKVKPATTEEPHQL
IPQVVDKNSVDSGEKCVDHFADCPHFAQYCTRASFFFVMKSYCPFTCKHCPGDRKLKKSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcattccgtcggattttggcacgaacactcgagagctgatcgcgatgatcacattaag
atcaactgggataatattctgcctggaatgaagtctcaattcgataaaatttcggcagtg
ttacaagatcttcaaggagaaaactacgattacaaatcaataatgcactatgacagcact
gcgttttcaagaaacggacgaaacacaatagaaactgtagaaaatggattcacacaggtt
attgggaccgctatggacttgtcacctctggatattgtgaaaatcaacaaactgtattcg
tgtaaaactaagaagaaagagaaagtaaagcctgcaactaccgaggaacctcatcaactg
attccgcaagttgtggataaaaattcggtcgattctggagaaaaatgtgtcgatcatttt
gcggattgcccgcactttgcacaatactgtacccgtgcttcatttttctttgttatgaaa
tcgtactgtccatttacgtgtaaacattgtcctggtgatcgaaaactcaaaaaatcggga
tga

DBGET integrated database retrieval system