KEGG   Caenorhabditis elegans (nematode): CELE_B0024.13Help
Entry
CELE_B0024.13     CDS       T00019                                 

Definition
Protein B0024.13
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CELE_B0024.13
    1.3.1.94  polyprenol reductase
     CELE_B0024.13
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10320718..10320917,10320968..10321116,10321541..10321732,10321779..10322044,10322093..10322215)
Genome map
AA seq 309 aa AA seqDB search
MLDRLWEVRQALPLYLLVSTLGLAISCCFTLICPHVCRLIPALTTYGKAADQQEDNSLVE
KISVPKKWFKHFYAIGLLTLFICLHTVHSLIYNPNYLHPVVLKILATLTRSYSIPPITPS
TSILALLLISLHVARRLYETIFVSVYSDSRMNLFHYAVGIVHYIILPISIMCETQGVASK
LPQLHVSIDDISLTQWAGAVLFWICNWKQHQLAEQIANTRKGPRGLIRNYAYGICFGGWF
NLVSCPHFLFEICIYLSLFLVIPDAYVYRFIIMFVCINQTFAALITHSWYHKTFPKYPKS
RKALIPYVL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttagatagactttgggaagtgcgccaagcactgcccctttatctgttagtatctacg
cttggacttgccatttcatgttgttttactctcatatgtcctcacgtttgtcgattgata
cctgcactaactacatatggaaaagctgctgatcaacaagaagataactctttggtagaa
aaaatatctgtacctaaaaaatggtttaagcatttttacgcaatcggtcttctaacactt
tttatatgtctacacactgtccactcgttaatctacaatcctaattatctgcatccagtg
gttctcaagattcttgccacgctaacacgatcctacagtataccaccaattaccccaagc
acatcaatcttggctctcctgctcataagccttcacgtagcacgacgtctctatgaaaca
atatttgtcagtgtttactcggacagtcgtatgaacttgtttcactatgcagttgggata
gtccactacatcattctgccaatttcaattatgtgtgaaacacagggagttgcttccaaa
ttacctcagcttcacgtgtcaattgatgatatttctctcacccaatgggctggagctgtc
cttttttggatttgcaattggaaacaacatcagctagccgaacaaatagcaaatacaaga
aaaggtcctagaggactaattcgcaattacgcctatggtatctgctttggtggttggttc
aatctcgtctcatgtcctcactttctattcgagatatgcatctacttgtcactttttctt
gtaattcctgatgcctacgtgtatagattcataatcatgttcgtgtgcatcaatcaaacg
tttgctgctctcatcactcactcctggtaccacaaaacattcccaaaatatccgaaaagt
cggaaagctctcattccttacgttctatga

DBGET integrated database retrieval system