KEGG   Caenorhabditis elegans (nematode): CELE_B0035.8Help
Entry
CELE_B0035.8      CDS       T00019                                 

Gene name
his-48
Definition
(RefSeq) Probable histone H2B 4
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CELE_B0035.8 (his-48)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_B0035.8 (his-48)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W fn3_4 DUF1931 Endonuc-HincII
Motif
Other DBs
NCBI-GeneID: 178049
NCBI-ProteinID: NP_502132
WormBase: WBGene00001922
UniProt: Q27876
Position
IV:11324745..11325116
Genome map
AA seq 123 aa AA seqDB search
MPPKPSAKGAKKAAKTVVAKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaagccatctgccaagggagccaagaaggccgccaagaccgtcgttgccaag
ccaaaggacggaaagaagagacgtcatgcccgcaaggaatcgtactccgtctacatctac
cgtgttctcaagcaagttcacccagacaccggagtctcctccaaggccatgtctatcatg
aactccttcgtcaatgatgtattcgaacgcatcgcttcggaagcttcccgtcttgctcat
tacaacaaacgctcaacgatctcatcccgcgaaattcaaaccgctgtccgtttgattctc
ccaggagaacttgccaagcacgccgtgtctgagggaaccaaggccgtcaccaagtacact
tccagcaagtaa

DBGET integrated database retrieval system