KEGG   Caenorhabditis elegans (nematode): CELE_B0207.4Help
Entry
CELE_B0207.4      CDS       T00019                                 

Gene name
air-2
Definition
Protein AIR-2
Orthology
K11479  
aurora kinase B [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(5937486..5937553,5937603..5937711,5937788..5938155,5938219..5938492,5938593..5938691)
Genome map
AA seq 305 aa AA seqDB search
MENKPPVINLPEKETVNTPQKGGKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKV
LFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLT
VSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPS
NKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKA
ARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKIEKEA
SLRNH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagaataagccacctgtaatcaaccttccagagaaggaaactgtgaatactccacag
aagggaggaaaatttactattaacgatttcgagatcggaagaccactgggaaaaggaaaa
ttcggcagtgtttacctggctcgcacaaaaactggacatttccatgtagcgatcaaggtt
ctattcaaatcgcaactcatctcaggaggcgtcgagcatcaattggagcgtgaaattgag
attcaatctcatttgaatcacccgaatattatcaagctctacacatatttttgggatgcg
aagaagatctatctcgttttggaatatgcccccggaggcgaaatgtacaagcaattgaca
gtgagcaagagattctcagagccaacagctgcaaaatatatgtatgagatcgcagatgct
ttgtcatattgccacaggaaaaatgtgattcatcgcgacattaaaccggagaatttgctt
atcggatcacaaggagaattgaaaattggagattttggatggagtgttcatgctccttcg
aataagcgccaaacaatgtgcggaacaatggactatctccctcctgaaatggtgaatgga
gccgatcacagtgacgcagttgacttatgggcaatcggcgttctctgctatgagtttctc
gttggaaaacccccattcgagcacgaagatcagtccaagacatatgcggcaatcaaagcg
gcacggtttacttaccctgattctgtgaagaagggtgcacgagatttgattggaagattg
cttgtcgttgatcccaaggctcgctgtacgcttgaacaggtgaaggaacactactggatc
cagggaatgatggaggcaaaaattagagctgagaagcagcaaaagattgaaaaagaagca
agtcttcggaatcactga

DBGET integrated database retrieval system