KEGG   Caenorhabditis elegans (nematode): CELE_B0207.4Help
Entry
CELE_B0207.4      CDS       T00019                                 

Gene name
air-2
Definition
Protein AIR-2
Orthology
K11479  
aurora kinase B [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_B0207.4 (air-2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   CELE_B0207.4 (air-2)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_B0207.4 (air-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(5937484..5937551,5937601..5937709,5937786..5938153,5938217..5938490,5938591..5938689)
Genome map
AA seq 305 aa AA seqDB search
MENKPPVINLPEKETVNTPQKGGKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKV
LFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLT
VSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPS
NKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKA
ARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKIEKEA
SLRNH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagaataagccacctgtaatcaaccttccagagaaggaaactgtgaatactccacag
aagggaggaaaatttactattaacgatttcgagatcggaagaccactgggaaaaggaaaa
ttcggcagtgtttacctggctcgcacaaaaactggacatttccatgtagcgatcaaggtt
ctattcaaatcgcaactcatctcaggaggcgtcgagcatcaattggagcgtgaaattgag
attcaatctcatttgaatcacccgaatattatcaagctctacacatatttttgggatgcg
aagaagatctatctcgttttggaatatgcccccggaggcgaaatgtacaagcaattgaca
gtgagcaagagattctcagagccaacagctgcaaaatatatgtatgagatcgcagatgct
ttgtcatattgccacaggaaaaatgtgattcatcgcgacattaaaccggagaatttgctt
atcggatcacaaggagaattgaaaattggagattttggatggagtgttcatgctccttcg
aataagcgccaaacaatgtgcggaacaatggactatctccctcctgaaatggtgaatgga
gccgatcacagtgacgcagttgacttatgggcaatcggcgttctctgctatgagtttctc
gttggaaaacccccattcgagcacgaagatcagtccaagacatatgcggcaatcaaagcg
gcacggtttacttaccctgattctgtgaagaagggtgcacgagatttgattggaagattg
cttgtcgttgatcccaaggctcgctgtacgcttgaacaggtgaaggaacactactggatc
cagggaatgatggaggcaaaaattagagctgagaagcagcaaaagattgaaaaagaagca
agtcttcggaatcactga

DBGET integrated database retrieval system