KEGG   Caenorhabditis elegans (nematode): CELE_B0286.3Help
Entry
CELE_B0286.3      CDS       T00019                                 

Definition
Protein B0286.3
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CELE_B0286.3
Enzymes [BR:cel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     CELE_B0286.3
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     CELE_B0286.3
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(4369751..4369774,4369817..4370017,4370062..4370346,4370675..4370851,4371149..4371637,4372424..4372519))
Genome map
AA seq 423 aa AA seqDB search
MSSLAEIASRPENLELLAEGKTKQIFDIKGEKDYVLIRSKDSLTAFNAVRKNELEGKSRI
ASKTTSNVFEYLQLLGLPTHFEKSISETEFVARKCTMIPIEWVARRVATGSFLKRNPGVK
EGFRFNDLKLETFFKDDANDDPQWTDEQIVSNGLMIDHLKIGREEISLMKKMTKLVFRAL
EKGWALSNSALIDMKIEFGVTVEGEILLADVIDNDSWRVWPENDRRLQLDKQVYRDMKEV
TEEGLALVLKNYTKVMDITATFSKHQQKCHVLVIMGSGSDGVFARKISDEAKKFGLETTL
KVSSAHKTTSDTLEVIADFEESGVPTVVIAVAGRSNGLGPVIAGNSSLPVINCPPPSEST
SLDIWSSLRMPNGIGCTTVLDPSEAALAAAKILASHNHIVFGKVLTAQLKNQINIYNANR
KLE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgttggctgaaatcgcgtcgagacccgaaaacttggagcttcttgctgaagga
aaaaccaagcaaatctttgatattaaaggagaaaaggattatgtgctcattcgttccaaa
gatagcttgaccgcattcaacgctgtccgtaaaaatgagcttgaaggaaagtctagaatc
gcaagtaaaaccacatcaaacgtgtttgaatatcttcaacttctcggtctaccaacacac
tttgaaaaaagcatctctgaaactgaatttgtcgcccgtaaatgcaccatgattccgatt
gaatgggtggcacgacgtgttgcgacaggatccttcttgaagagaaatcctggagttaaa
gagggtttcagatttaatgatctgaaattggagacatttttcaaagacgacgctaatgat
gatccacaatggactgatgaacaaattgtgtcgaatggtttgatgattgatcatttgaaa
attggaagagaagagatttcattgatgaagaagatgacaaagttggtgtttagagcattg
gagaaaggatgggctctttcaaatagtgctctgattgatatgaagatcgaattcggagtc
acagttgaaggagaaattctcctggccgacgtgattgacaatgactcgtggagagtttgg
cctgaaaatgatagacgtctgcagttggataagcaagtttacagggatatgaaggaagtg
acagaagaggggttggctctcgttttgaagaattatacaaaggttatggatatcactgcc
accttctcaaaacaccagcaaaaatgccatgttcttgtgatcatgggatctggttcggat
ggcgtattcgcacggaaaatctctgatgaagccaagaaatttggactggaaactacgctg
aaagtaagctcagctcataaaactacctcggacactctggaagttatcgctgatttcgaa
gaaagtggagttccgacagttgtgattgcagtagctggaagatccaatggactcggtcca
gttattgctggaaactcgtctcttccggtgatcaactgcccgccaccaagtgaatcaacg
agtcttgacatttggtcatcactccgaatgccgaatggaatcgggtgtactacagtgttg
gacccatcggaggccgcgcttgccgccgcaaaaatcctcgcgtctcacaatcatattgtg
tttggaaaagtgctcactgcacagctcaagaatcaaatcaacatttacaacgccaatcgc
aaacttgaatag

DBGET integrated database retrieval system