KEGG   Caenorhabditis elegans (nematode): CELE_B0403.4Help
Entry
CELE_B0403.4      CDS       T00019                                 

Gene name
tag-320
Definition
Protein TAG-320
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_B0403.4 (tag-320)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_B0403.4 (tag-320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(7066539..7066854,7066906..7067569,7067992..7068300,7068407..7068440))
Genome map
AA seq 440 aa AA seqDB search
MALIKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSL
VPEYKKAASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQ
AIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLN
SKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGKVRLGALDATVHTVVANKFAIRGFPTI
KYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVFEGINQQVVEDACKEKQLC
IFAFLPHILDCQSECRNNYLAMLKEQSEKFKKNLWGWIWVEGAAQPALEESFEVGGFGYP
AMTALNFRKNKYAVLKGSFGKDGIHEFLRDLSYGKGRTSSLRGDGFPKIQKTEKWDGKDG
ALPAEDDIDLSDIDLDKTEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctctcatcaagttgctcctcgcatctttggcgataacttcggtatgtggaatgtac
tcaaaaaaggatgatgtcgtcgagctgaccgaggccaatttccaatcaaaggttatcaac
tctgatgatatttggattgttgagttctatgctccatggtgcggtcactgcaagagtctg
gtcccagaatacaagaaagctgcttcagcactcaagggagtcgccaaggttggagccgtt
gatatgactcaacatcaatccgtcggaggaccatacaatgttcaaggattcccaactctc
aagatcttcggagccgacaagaagaagccaacagactacaacggacaaagaactgctcag
gcaatcgctgactcggttctcgctgaagccaaaaaggcagtctctgctcggcttggagga
aaatcatcaggaagcagcagcagtggatccggatctggatctggaaagcgtggaggaggt
ggatctggaaatgaagttgttgaacttactgatgccaacttcgaggatctcgttctcaac
agcaaggatatctggcttgtcgagttctttgccccatggtgcggacactgcaaaagcctt
gagccacaatggaaggccgccgcttctgaactcaagggcaaagttcgtctcggagctctc
gacgccactgttcatactgtcgtcgccaacaagttcgccattcgtggattcccaaccatc
aagtatttcgctccaggatctgatgtttctgacgctcaagactacgatggaggacgtcaa
tcttctgacatcgttgcctgggcttcagctcgtgctcaagaaaacatgccagctccagag
gtctttgaaggaatcaaccaacaagtcgtagaggatgcatgcaaggagaaacagctttgc
atttttgccttcctcccacacattcttgactgccaatcggagtgcagaaacaattatttg
gctatgctcaaggagcaatccgagaaattcaagaagaacctttggggatggatttgggtt
gaaggagccgctcagccagctcttgaggagtccttcgaagttggaggttttggatatcca
gccatgactgctttgaacttccgcaagaacaagtacgccgtgctcaagggatccttcgga
aaagatggaatccacgagttcctccgtgatctctcgtatggaaagggacgcacttcttcc
cttcgaggagatggattcccaaagattcagaagactgagaagtgggacggaaaggacgga
gcccttccagctgaagacgacatcgacttgtctgacattgacctcgataagaccgagctt
taa

DBGET integrated database retrieval system