KEGG   Caenorhabditis elegans (nematode): CELE_B0478.1Help
Entry
CELE_B0478.1      CDS       T00019                                 

Gene name
jnk-1
Definition
Protein JNK-1, isoform A
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_B0478.1 (jnk-1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_B0478.1 (jnk-1)
   04012 ErbB signaling pathway
    CELE_B0478.1 (jnk-1)
   04310 Wnt signaling pathway
    CELE_B0478.1 (jnk-1)
   04068 FoxO signaling pathway
    CELE_B0478.1 (jnk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_B0478.1 (jnk-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_B0478.1 (jnk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(6957677..6957722,6960209..6960318,6960727..6960885,6960933..6961018,6961142..6961271,6961321..6961518,6961797..6961962,6962123..6962221,6962270..6962348,6962406..6962482,6962526..6962641,6963467..6963592)
Genome map
AA seq 463 aa AA seqDB search
MEERLSTTSSYPSHPGRSVEEDHNTLLASSSISSIIRGTRGHLNNFIESVGNWLVPSSSG
RDDDAVSLDSCQSVYSPVRHHINSGTGGGILMEPSSIHVPENYYSVTIGEAQMVVLKRYQ
NLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIG
ILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGI
IHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVD
VWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQ
ATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDE
IEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgattatccacaacatcatcgtatccgtcacatccaggtagaagcgtggaa
gaggatcacaacactctgctcgcatcctcctcgatatcatcaatcattcgaggaacccgt
ggacacctcaacaattttatcgagtccgttgggaattggctggttccatcatcatctggt
cgagacgacgacgctgtctctttggatagttgccaatcagtgtacagtcctgttcgtcat
cacataaacagtggaacaggaggaggaattctcatggaaccatcctctattcatgttccc
gaaaactattattcggtgacaataggggaagcgcagatggttgttctcaaacgatatcaa
aatctcaggttgatcgggtctggtgctcagggaattgtttgctcagcgtttgatacggta
cggaacgaacaagttgccataaagaaattatcaaggccatttcaaaatgtgacacatgca
aagagggcttatcgagaattaaaactcatgagtcttgtaaatcataaaaatatcataggt
attctgaattgttttacaccacaaaagaaactcgacgaattcaacgatctttatattgtt
atggaacttatggatgcaaatctttgtcaagtgattcaaatggatttggatcatgagaga
ttatcatatcttctttatcaaatgttatgtggtatcaggcatttacatagtgctggaatt
atacacagggatttgaaaccatcaaacattgtcgttcgaagtgattgtactctaaaaatc
ttggatttcggattggctcgaactgcgattgaggcattcatgatgactccttacgttgtg
acaagatactatcgggcaccggaagttattttaggaatgggttacaaggaaaatgttgat
gtttggtcaattgggtgtatatttggagagctgatacgtggacgtgtactattcccgggt
ggtgaccatatcgatcagtggactaggattattgaacaattgggtactccggataggtca
tttttagaacggttacaaccaactgtcagaaattatgtggaaaatcggccaagatatcaa
gcaacgccgtttgaagttctcttcagtgataacatgttcccaatgacagctgacagctca
agacttacaggtgctcaagctcgtgacttactttctcgaatgttagtcatagatccggaa
agaaggatttctgtggatgatgcactgagacatccatatgtcaatgtttggtttgatgaa
attgaagtatatgctccacctccacttccgtatgatcataatatggatgtggaacagaac
gtggattcatggagagagcacattttccgagagctcacagattacgcaagaacccatgac
atttattcctga

DBGET integrated database retrieval system