KEGG   Caenorhabditis elegans (nematode): CELE_B0478.1Help
Entry
CELE_B0478.1      CDS       T00019                                 

Gene name
jnk-1
Definition
Protein JNK-1, isoform A
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cel04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cel04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cel04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cel04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cel04068]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(6957666..6957711,6960198..6960307,6960716..6960874,6960922..6961007,6961131..6961260,6961310..6961507,6961786..6961951,6962112..6962210,6962259..6962337,6962395..6962471,6962515..6962630,6963456..6963581)
Genome map
AA seq 463 aa AA seqDB search
MEERLSTTSSYPSHPGRSVEEDHNTLLASSSISSIIRGTRGHLNNFIESVGNWLVPSSSG
RDDDAVSLDSCQSVYSPVRHHINSGTGGGILMEPSSIHVPENYYSVTIGEAQMVVLKRYQ
NLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIG
ILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGI
IHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVD
VWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQ
ATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDE
IEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgattatccacaacatcatcgtatccgtcacatccaggtagaagcgtggaa
gaggatcacaacactctgctcgcatcctcctcgatatcatcaatcattcgaggaacccgt
ggacacctcaacaattttatcgagtccgttgggaattggctggttccatcatcatctggt
cgagacgacgacgctgtctctttggatagttgccaatcagtgtacagtcctgttcgtcat
cacataaacagtggaacaggaggaggaattctcatggaaccatcctctattcatgttccc
gaaaactattattcggtgacaataggggaagcgcagatggttgttctcaaacgatatcaa
aatctcaggttgatcgggtctggtgctcagggaattgtttgctcagcgtttgatacggta
cggaacgaacaagttgccataaagaaattatcaaggccatttcaaaatgtgacacatgca
aagagggcttatcgagaattaaaactcatgagtcttgtaaatcataaaaatatcataggt
attctgaattgttttacaccacaaaagaaactcgacgaattcaacgatctttatattgtt
atggaacttatggatgcaaatctttgtcaagtgattcaaatggatttggatcatgagaga
ttatcatatcttctttatcaaatgttatgtggtatcaggcatttacatagtgctggaatt
atacacagggatttgaaaccatcaaacattgtcgttcgaagtgattgtactctaaaaatc
ttggatttcggattggctcgaactgcgattgaggcattcatgatgactccttacgttgtg
acaagatactatcgggcaccggaagttattttaggaatgggttacaaggaaaatgttgat
gtttggtcaattgggtgtatatttggagagctgatacgtggacgtgtactattcccgggt
ggtgaccatatcgatcagtggactaggattattgaacaattgggtactccggataggtca
tttttagaacggttacaaccaactgtcagaaattatgtggaaaatcggccaagatatcaa
gcaacgccgtttgaagttctcttcagtgataacatgttcccaatgacagctgacagctca
agacttacaggtgctcaagctcgtgacttactttctcgaatgttagtcatagatccggaa
agaaggatttctgtggatgatgcactgagacatccatatgtcaatgtttggtttgatgaa
attgaagtatatgctccacctccacttccgtatgatcataatatggatgtggaacagaac
gtggattcatggagagagcacattttccgagagctcacagattacgcaagaacccatgac
atttattcctga

DBGET integrated database retrieval system