KEGG   Caenorhabditis elegans (nematode): CELE_B0478.1Help
Entry
CELE_B0478.1      CDS       T00019                                 

Gene name
jnk-1
Definition
Protein JNK-1, isoform A
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_B0478.1 (jnk-1)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CELE_B0478.1 (jnk-1)
   04012 ErbB signaling pathway
    CELE_B0478.1 (jnk-1)
   04310 Wnt signaling pathway
    CELE_B0478.1 (jnk-1)
   04068 FoxO signaling pathway
    CELE_B0478.1 (jnk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_B0478.1 (jnk-1)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_B0478.1 (jnk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(6957677..6957722,6960209..6960318,6960727..6960885,6960933..6961018,6961142..6961271,6961321..6961518,6961797..6961962,6962123..6962221,6962270..6962348,6962406..6962482,6962526..6962641,6963467..6963592)
Genome map
AA seq 463 aa AA seqDB search
MEERLSTTSSYPSHPGRSVEEDHNTLLASSSISSIIRGTRGHLNNFIESVGNWLVPSSSG
RDDDAVSLDSCQSVYSPVRHHINSGTGGGILMEPSSIHVPENYYSVTIGEAQMVVLKRYQ
NLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIG
ILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGI
IHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVD
VWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQ
ATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDE
IEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacgattatccacaacatcatcgtatccgtcacatccaggtagaagcgtggaa
gaggatcacaacactctgctcgcatcctcctcgatatcatcaatcattcgaggaacccgt
ggacacctcaacaattttatcgagtccgttgggaattggctggttccatcatcatctggt
cgagacgacgacgctgtctctttggatagttgccaatcagtgtacagtcctgttcgtcat
cacataaacagtggaacaggaggaggaattctcatggaaccatcctctattcatgttccc
gaaaactattattcggtgacaataggggaagcgcagatggttgttctcaaacgatatcaa
aatctcaggttgatcgggtctggtgctcagggaattgtttgctcagcgtttgatacggta
cggaacgaacaagttgccataaagaaattatcaaggccatttcaaaatgtgacacatgca
aagagggcttatcgagaattaaaactcatgagtcttgtaaatcataaaaatatcataggt
attctgaattgttttacaccacaaaagaaactcgacgaattcaacgatctttatattgtt
atggaacttatggatgcaaatctttgtcaagtgattcaaatggatttggatcatgagaga
ttatcatatcttctttatcaaatgttatgtggtatcaggcatttacatagtgctggaatt
atacacagggatttgaaaccatcaaacattgtcgttcgaagtgattgtactctaaaaatc
ttggatttcggattggctcgaactgcgattgaggcattcatgatgactccttacgttgtg
acaagatactatcgggcaccggaagttattttaggaatgggttacaaggaaaatgttgat
gtttggtcaattgggtgtatatttggagagctgatacgtggacgtgtactattcccgggt
ggtgaccatatcgatcagtggactaggattattgaacaattgggtactccggataggtca
tttttagaacggttacaaccaactgtcagaaattatgtggaaaatcggccaagatatcaa
gcaacgccgtttgaagttctcttcagtgataacatgttcccaatgacagctgacagctca
agacttacaggtgctcaagctcgtgacttactttctcgaatgttagtcatagatccggaa
agaaggatttctgtggatgatgcactgagacatccatatgtcaatgtttggtttgatgaa
attgaagtatatgctccacctccacttccgtatgatcataatatggatgtggaacagaac
gtggattcatggagagagcacattttccgagagctcacagattacgcaagaacccatgac
atttattcctga

DBGET integrated database retrieval system