KEGG   Caenorhabditis elegans (nematode): CELE_B0546.2Help
Entry
CELE_B0546.2      CDS       T00019                                 

Gene name
otub-4
Definition
Protein OTUB-4
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_B0546.2 (otub-4)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   CELE_B0546.2 (otub-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(3373631..3373752,3374435..3374785,3375339..3375500,3376172..3376484,3376988..3377160,3377868..3377986,3378034..3378104))
Genome map
AA seq 436 aa AA seqDB search
MTILPVKKKREKDSQQRSVSTIGSSAENSRQQLSGPSCSSSASSSSSAAKRIRSQEDGPP
SKRWVLSASSTSSTNKSPIPSSSPVLPPPQPEIEPNRSQSPGNADYNSDDEYEMQNIRDD
EIETEFSNRLAARGLIIKEMVGDGACMFRSIAEQIYGDQEMHGQIRRLCMDYMSNNRDHF
KEFITENFENYIQRKREENVHGNHVELQAISEMFARPVEVYQYSDEPINVLLPRPEPEAT
ALTDGSASTSNAAPPPSTVPIQQNPPLRLSYHRAVHYNAILAPNIPTIGIGLGLPGMIPG
SADKELMSTAMKTSELEHIEETMLQDKIDMTDFQRTQADIEDQITRESLISYLNDFEKSK
NAPSTSAGAPGPSNFSGEPPVSGSGLYEEMLAAQSLEWDAYTDDVAIAEAMLVSQQDYMS
NKPSTSSSGSGPSTSE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttaccagtaaaaaaaaagcgcgaaaaggattcccagcagagatcagtttca
acaattggaagttctgctgaaaatagccgtcaacaactctctggaccatcctgcagctca
tcagcttcatcttcgagctccgcggctaaaaggatccgttctcaggaggatggacctccg
agcaagcgatgggtcctatcggcttcatctacctcatcaacgaacaaaagcccaattcca
tcatcatcaccagtcctaccaccacctcaacctgaaattgagccaaatcgaagccaatct
ccaggaaatgccgactataattcagacgatgaatatgaaatgcaaaatattcgagacgat
gagatcgaaacggaattctcgaatcgtctggcggcccgtggcctaataatcaaagaaatg
gtcggcgacggagcctgtatgttccgttcaattgccgaacaaatctacggtgatcaggaa
atgcacggacaaattcgccgtctttgtatggattatatgtcgaataaccgcgatcatttc
aaagaattcattacggaaaactttgagaattatattcaacgaaaacgcgaggaaaatgtg
cacgggaatcatgttgagcttcaagcgatctctgaaatgtttgcacggcctgtagaggtg
tatcagtacagtgatgaaccaataaatgtgcttcttccccgtccggaaccagaagctact
gctctaacagatggctccgcgtccacatcgaatgctgctccgccgccgtctacagtacca
attcaacagaatccaccgcttcggcttagttatcatcgagctgttcactataatgctatt
cttgctccaaacattccaacaatcggaatcggtctcggattacccggaatgataccagga
tcagctgataaagagttaatgagcacagcaatgaagacctcggagttggagcatattgaa
gaaacgatgctccaggataaaatcgatatgacagattttcaacgaactcaggcggatatt
gaagatcaaattactcgagaatccctaatttcatacttaaatgactttgaaaagtctaaa
aatgctccgtcgacgtcagctggagctcctgggccatccaatttcagtggagagccgccg
gtatcaggctcaggactatacgaggaaatgctcgccgctcagagcttggaatgggacgcc
tacaccgacgacgttgcaattgccgaagcgatgctcgtcagccaacaggactatatgagc
aataagccgagcacgagcagcagtggcagtggtccaagtacttctgaataa

DBGET integrated database retrieval system