KEGG   Caenorhabditis elegans (nematode): CELE_C04E6.5Help
Entry
CELE_C04E6.5      CDS       T00019                                 

Gene name
C04E6.5
Definition
Protein C04E6.5
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_C04E6.5 (C04E6.5)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_C04E6.5 (C04E6.5)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CELE_C04E6.5 (C04E6.5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(5902248..5902310,5902381..5902515,5903000..5903091,5903141..5903287,5903334..5903586,5903634..5903911,5904160..5904285,5904332..5904575,5904622..5904831)
Genome map
AA seq 515 aa AA seqDB search
MRDFVTDINNATEELLKLNLESAVTQDTFNLLVVYFNDLLVGKEKEIAELKEEIEELKKP
LEENKMAPLLEIVRSEVFPEQLEHPSKNATNTGSRKRAHPKLFEASEPKVKSSNVSTDVI
DGKKHNNRKTNSSRSFSKVNSSVTRKLVNTGNSCFLNSTMQALSSCHSFALRCEQLYCLV
RKNIDYFDNEASHSEVLCRKYRVLIDFLKIMAALTKRSNSSKTQPEIIEANLQTFRELIG
MIRNDFANKNQQDAHEFLLMLFEAIDDVAEYKADNEGDDVKEAKQLNPIEAFKFNVETCY
VCKGCSKEEVRVDVRNDLAVHMRDNLSVQELLSSSFSTWTPIEKKCSSCNHQHAILSERI
TRFPECLVINLERYQLEGPQFSTKKINCSLEPSFELDISSLQKFPEIEKNGLEQSEKQQD
SQYGQLLDRMKSCEIIKCCETKNIIMEEKHDKYSLVAAICHLGETPTNGHYIAYTREDTE
NSWLYCSDDLIRPATRSEISLSIRTSGYILFYEYE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagagactttgtaacggatatcaataatgcaactgaagagctcttgaaacttaattta
gagagtgcagtgacacaagacacatttaatctacttgtcgtctatttcaatgatttgttg
gttggtaaagaaaaggagatagcggaactcaaagaagaaatagaggaattgaaaaagcca
ttggaagaaaataaaatggcaccactcctggaaatcgtcagatcagaagtatttccggag
cagctagagcatccttcgaagaatgcaacaaacacgggaagtaggaaaagagcacaccct
aaactcttcgaagcgagtgaaccaaaagtcaaatcttccaatgtgtctactgatgtaatt
gatgggaagaagcacaacaataggaagacgaattcttcgagatctttttcgaaagtcaac
tcgtctgtgaccaggaaacttgtgaacactggaaactcgtgttttttgaattcaacaatg
caggctttgtcttcgtgtcattcgtttgcacttaggtgtgaacaactttattgtctggtt
cggaaaaacatcgactatttcgataatgaagcgtcccattctgaagtcctctgccgaaaa
tacagagtgctcatagactttctcaagattatggctgctctcaccaaacgttccaattca
agcaaaactcaacctgaaattattgaagcaaatcttcaaacattccgagagcttattggt
atgatcaggaatgattttgcgaacaaaaatcagcaggatgcccacgagtttctactaatg
ctatttgaggcaatcgatgacgtggcagaatacaaagccgacaatgagggagatgatgtg
aaggaagctaagcagctgaatccaattgaagcatttaaatttaacgtggaaacatgttac
gtttgcaaaggatgcagcaaggaggaagtgagagtagatgttcggaatgatttggcggtt
cacatgagagataacctgtccgtacaagaattgctatcgtcatcgttctctacatggacg
ccaatcgagaagaaatgctcatcgtgcaaccaccaacatgcaattctgagcgaacgaatt
acgagatttccagaatgcttagtcattaacctcgaaagatatcaactcgagggacctcaa
ttttctacaaaaaagatcaattgctccttggaaccatcatttgaacttgatatttcgtcg
ttacaaaagtttcctgaaattgagaaaaatggcttggagcaatcagagaagcaacaagac
tctcaatatggacagttacttgatagaatgaaatcctgcgagatcataaagtgttgtgaa
acaaaaaatattatcatggaagagaaacatgacaagtattcactcgttgctgccatttgc
catcttggcgaaacaccgacaaatggacactacatagcctacacaagagaagatacggaa
aattcttggctctattgctcggatgaccttattcggcctgcaacaagatctgagatatcc
ttgtctattcgaacttctggctatattttgttctacgaatatgaataa

DBGET integrated database retrieval system