KEGG   Caenorhabditis elegans (nematode): CELE_C04E6.5Help
Entry
CELE_C04E6.5      CDS       T00019                                 

Definition
Protein C04E6.5
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(5902231..5902293,5902364..5902498,5902983..5903074,5903124..5903270,5903317..5903569,5903617..5903894,5904143..5904268,5904315..5904558,5904605..5904814)
Genome map
AA seq 515 aa AA seqDB search
MRDFVTDINNATEELLKLNLESAVTQDTFNLLVVYFNDLLVGKEKEIAELKEEIEELKKP
LEENKMAPLLEIVRSEVFPEQLEHPSKNATNTGSRKRAHPKLFEASEPKVKSSNVSTDVI
DGKKHNNRKTNSSRSFSKVNSSVTRKLVNTGNSCFLNSTMQALSSCHSFALRCEQLYCLV
RKNIDYFDNEASHSEVLCRKYRVLIDFLKIMAALTKRSNSSKTQPEIIEANLQTFRELIG
MIRNDFANKNQQDAHEFLLMLFEAIDDVAEYKADNEGDDVKEAKQLNPIEAFKFNVETCY
VCKGCSKEEVRVDVRNDLAVHMRDNLSVQELLSSSFSTWTPIEKKCSSCNHQHAILSERI
TRFPECLVINLERYQLEGPQFSTKKINCSLEPSFELDISSLQKFPEIEKNGLEQSEKQQD
SQYGQLLDRMKSCEIIKCCETKNIIMEEKHDKYSLVAAICHLGETPTNGHYIAYTREDTE
NSWLYCSDDLIRPATRSEISLSIRTSGYILFYEYE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagagactttgtaacggatatcaataatgcaactgaagagctcttgaaacttaattta
gagagtgcagtgacacaagacacatttaatctacttgtcgtctatttcaatgatttgttg
gttggtaaagaaaaggagatagcggaactcaaagaagaaatagaggaattgaaaaagcca
ttggaagaaaataaaatggcaccactcctggaaatcgtcagatcagaagtatttccggag
cagctagagcatccttcgaagaatgcaacaaacacgggaagtaggaaaagagcacaccct
aaactcttcgaagcgagtgaaccaaaagtcaaatcttccaatgtgtctactgatgtaatt
gatgggaagaagcacaacaataggaagacgaattcttcgagatctttttcgaaagtcaac
tcgtctgtgaccaggaaacttgtgaacactggaaactcgtgttttttgaattcaacaatg
caggctttgtcttcgtgtcattcgtttgcacttaggtgtgaacaactttattgtctggtt
cggaaaaacatcgactatttcgataatgaagcgtcccattctgaagtcctctgccgaaaa
tacagagtgctcatagactttctcaagattatggctgctctcaccaaacgttccaattca
agcaaaactcaacctgaaattattgaagcaaatcttcaaacattccgagagcttattggt
atgatcaggaatgattttgcgaacaaaaatcagcaggatgcccacgagtttctactaatg
ctatttgaggcaatcgatgacgtggcagaatacaaagccgacaatgagggagatgatgtg
aaggaagctaagcagctgaatccaattgaagcatttaaatttaacgtggaaacatgttac
gtttgcaaaggatgcagcaaggaggaagtgagagtagatgttcggaatgatttggcggtt
cacatgagagataacctgtccgtacaagaattgctatcgtcatcgttctctacatggacg
ccaatcgagaagaaatgctcatcgtgcaaccaccaacatgcaattctgagcgaacgaatt
acgagatttccagaatgcttagtcattaacctcgaaagatatcaactcgagggacctcaa
ttttctacaaaaaagatcaattgctccttggaaccatcatttgaacttgatatttcgtcg
ttacaaaagtttcctgaaattgagaaaaatggcttggagcaatcagagaagcaacaagac
tctcaatatggacagttacttgatagaatgaaatcctgcgagatcataaagtgttgtgaa
acaaaaaatattatcatggaagagaaacatgacaagtattcactcgttgctgccatttgc
catcttggcgaaacaccgacaaatggacactacatagcctacacaagagaagatacggaa
aattcttggctctattgctcggatgaccttattcggcctgcaacaagatctgagatatcc
ttgtctattcgaacttctggctatattttgttctacgaatatgaataa

DBGET integrated database retrieval system