KEGG   Caenorhabditis elegans (nematode): CELE_C05C8.7Help
Entry
CELE_C05C8.7      CDS       T00019                                 

Gene name
C05C8.7
Definition
(RefSeq) Uncharacterized protein
  KO
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CELE_C05C8.7 (C05C8.7)
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_C05C8.7 (C05C8.7)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     CELE_C05C8.7 (C05C8.7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Ensembl: 
UniProt: 
Position
V:complement(join(7243426..7243597,7243830..7244419,7244865..7245046,7245402..7245543,7245590..7245778,7246889..7247017))
Genome map
AA seq 467 aa AA seqDB search
MEQLKCHVKQYAWGKYGEESEVARLFADGHESFQIDQKTPYAELWMGTHPDGPAQLKKCS
TKLSTYLAKNPSPLTNNNSAKNIHLPFIMKVMSIRTTLSLQVHPTKEQARRLHEKDPIHY
PDRNHKPELAYALTRFELLCGFRPAREILQNLQTFPSFRLLFGGDTYAKPLEDCIQQMKD
LNSVDQKSTEFKDSRKYLEDCFRFMMVPERNDVHDLIAKLLSELDNGLRGAVEEVTVGVI
RKMSVDFPNDIGIFSPLFLNHMILEPGQCCYYAAEELHAYLSGECVECVGCSNNTIRAAM
TPKYIDRDALCSVLNYKMTEQKDYLVPENKLTECVDMYAPDCKDFQLHRIRVGTHQTVEE
MMIPTLDCASIFVVVSGKGTLEEATIDNQLIGQYEVKRGDIFYIPPKHNIRFSSCSEPLE
GYRTFSYEMGPDHDTRLVTPVQNAVPTITEKMFKLDADMEEAITAVV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggaacaactcaaatgccacgtcaaacagtatgcgtggggaaaatatggtgaggagagc
gaggtggcgagactatttgcagacggtcatgaaagtttccaaattgatcagaagacacca
tatgctgagctatggatgggaacccaccccgatggaccagctcagctcaagaaatgctcc
accaaactgtcgacgtacttggcaaagaacccatctccattgacaaacaacaattcggca
aagaacattcatttgccatttatcatgaaggtgatgtcgatcagaaccaccttgtcacta
caagttcatccaaccaaagaacaagctcgccgattgcatgagaaagaccctattcactat
cctgataggaatcacaaaccagagctggcctacgcacttacccgtttcgaacttctttgc
ggattccggccagctagagagattttgcagaaccttcagaccttcccatcattccggtta
cttttcggaggagacacgtatgctaaaccactcgaagattgcattcaacaaatgaaggat
ctgaactcagttgaccagaaatctacagaatttaaagactcgagaaaatatttggaggac
tgctttagatttatgatggttccagaaagaaatgatgttcatgacctgattgcaaagctt
ctttccgaacttgacaatgggcttcgtggtgcagttgaagaagtaacagtaggagtgatt
cgaaaaatgtcggttgattttccaaatgatattggaatcttctccccacttttcctcaat
cacatgattctcgaaccaggacaatgttgttattatgctgctgaagaacttcatgcctat
ctcagtggtgaatgtgttgaatgcgtgggatgttcaaacaatacgattcgggccgccatg
actccaaaatacattgacagagatgctctttgcagtgttcttaactacaagatgacagag
caaaaagattatttggtgccagagaacaagttgactgaatgtgttgatatgtatgcacca
gattgtaaagatttccaacttcatagaatacgagtaggaacacatcagactgttgaagaa
atgatgattccaactcttgattgcgcatccatctttgtagttgtcagcggaaaaggtaca
ctagaagaggcgacaattgacaatcagctgattggacagtatgaagttaaaagaggagat
atcttctatattccaccaaagcataatatcagattctcaagctgctcggaaccattagaa
ggatacaggacgtttagttacgaaatgggaccagatcatgacacacggctcgtcactcca
gttcaaaatgcggtgcctacgattactgagaaaatgttcaaattagatgcagatatggaa
gaagcgatcaccgctgttgtttaa

DBGET integrated database retrieval system