KEGG   Caenorhabditis elegans (nematode): CELE_C05D10.2Help
Entry
CELE_C05D10.2     CDS       T00019                                 

Gene name
C05D10.2
Definition
Protein C05D10.2, isoform A
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(6067840..6067887,6068271..6068351,6068396..6068523,6068717..6068866,6069793..6069877,6069976..6070132,6070180..6070384,6070529..6070760,6070914..6071058,6071560..6071741)
Genome map
AA seq 470 aa AA seqDB search
MTDDVDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFRE
VMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQ
LFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSSLEDYPEGQKMPDLTEY
VATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTIAKP
SRADIASIGSHYAASVLEKMPQRPRKPLDLIITQSQTAAIDMVQRLLIFAPQKRLTVEQC
LVHPYVVQFHNPSEEPVLNYEVYPPLPDHIQLSIDDYRDRLYEMIDEKKASFKRIQHEKI
RPYGEDKSRAPIAQAECSDTDYDTARSLQRTTSMDKNNSSSHDSSSGTLRERAASAESRT
SKDSNGEMRNGNGNTPSSIKQRRRSVERARLFANIKPSKILHPHKLISNY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgatgtggacacgcacattcatgagaaattcgacttgcagaaacgtctcgga
aaaggtgcatatggaattgtgtggaaagcatacgacaagaggtcgagggagacggtggct
ctgaaaaagattttcgacgctttccgaaatccgacagattcccagaggacatttcgagaa
gtgatgtttcttcaagaatttggaaaacatccaaatgttataaagttgtataacattttc
cgagcagataatgatagagatatctacttagcatttgagttcatggaagctgatctacat
aatgttataaaaaaagggtcgatattgaaagatgtccacaaacagtatatcatgtgccag
ttgttccgagcaattcgatttttgcattctgggaatgtgttacaccgggatttgaagcca
tcgaatgttctactggatgcagattgtcgtgtaaaacttgcagatttcggattagcgagg
agtctttcgtcgcttgaagattaccctgaaggccaaaaaatgccggatctaacagaatac
gtggcaacaagatggtacagaagtccggaaattctcctggcagccaaaagatacacaaaa
ggagtggatatgtggagtttgggatgcattttagctgagatgctgattggacgtgctctg
tttccgggatcttcgactattaatcaaatcgaacgaataatgaatacaatcgcaaaacct
tcaagagctgatattgcaagtattggaagtcactatgcagctagtgtgcttgagaaaatg
cctcaacggccgagaaaaccacttgatttgattataactcaatcacaaacagctgcgatt
gatatggttcagagattgttaatatttgctcctcaaaaacgattaaccgttgaacaatgc
ttggtacatccatatgtggtacaatttcataatccatcagaagaaccagtactcaactat
gaagtttatccaccacttccggatcatattcaattgagtattgacgattatcgtgatcga
ttgtatgagatgattgatgaaaagaaggccagttttaagaggatacaacatgaaaagatc
cgaccttacggcgaagataagagtcgtgctccgattgctcaggctgaatgcagtgatact
gattacgatacggcaagaagcttacaaagaacaacaagcatggataagaataatagtagt
tcgcatgatagtagttctggaactttaagagagcgagccgcttcagctgaaagtcgaacc
tcaaaagatagcaacggagagatgagaaatgggaatgggaatactccaagtagtatcaag
caacgtcgtcgttctgtcgaaagagctcgattatttgcaaatatcaagccttccaagatc
cttcacccacacaaattgatctcaaattattga

DBGET integrated database retrieval system