KEGG   Caenorhabditis elegans (nematode): CELE_C05D10.2Help
Entry
CELE_C05D10.2     CDS       T00019                                 

Gene name
C05D10.2
Definition
Protein C05D10.2, isoform B
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_C05D10.2 (C05D10.2)
Protein kinases [BR:cel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CELE_C05D10.2 (C05D10.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(6067891..6067938,6068322..6068402,6068447..6068578)
Genome map
AA seq 86 aa AA seqDB search
MTDDVDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFRE
VMFLQEFGKHPNVIKLYNIFRADNDR
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgatgtggacacgcacattcatgagaaattcgacttgcagaaacgtctcgga
aaaggtgcatatggaattgtgtggaaagcatacgacaagaggtcgagggagacggtggct
ctgaaaaagattttcgacgctttccgaaatccgacagattcccagaggacatttcgagaa
gtgatgtttcttcaagaatttggaaaacatccaaatgttataaagttgtataacattttc
cgagcagataatgataggtga

DBGET integrated database retrieval system