KEGG   Caenorhabditis elegans (nematode): CELE_C05D9.5Help
Entry
CELE_C05D9.5      CDS       T00019                                 

Gene name
ife-4
Definition
Protein IFE-4
Orthology
K03259  
translation initiation factor 4E
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_C05D9.5 (ife-4)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CELE_C05D9.5 (ife-4)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CELE_C05D9.5 (ife-4)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CELE_C05D9.5 (ife-4)
Translation factors [BR:cel03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CELE_C05D9.5 (ife-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(1104214..1104276,1104567..1104747,1105230..1105467,1105886..1106042)
Genome map
AA seq 212 aa AA seqDB search
MEAETSTQEVVKQVKNLPILMEDAPVGSDDHQLQYSYTFSYFMRPTGKFDPEDYASYVQP
VGIMKSVEQFWSIMVHFKRPTEMCDKADIHFFKTGVKPVWEDPANCKGGKWIIRLKKGLS
TRIWENLLMAIIGEQFLVGDELCGAVCSIRNQEDIISLWNRNADDTPVTNRIRETLRSVL
QLPQNTVLEYKRHDDCLRDQSSYRHTTKNICK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgaaacgtcaactcaggaagttgtgaagcaggtcaaaaatttgccaattttg
atggaagatgctccggtcggctctgacgatcaccaacttcaatattcatacacattttcg
tatttcatgaggccaactggcaaattcgatccggaagattatgctagttatgtgcagcct
gttggaataatgaagtctgtcgagcaattttggagtattatggtgcatttcaaacggcca
actgaaatgtgcgacaaagctgacattcacttcttcaaaactggcgtcaaaccagtgtgg
gaagatccggcgaactgcaaaggtggaaaatggattatccgactgaagaaaggattgtcg
acaagaatttgggagaatctgctcatggcaatcattggagagcagtttttggttggagat
gagctctgtggagctgtgtgctcaattcgcaatcaggaagatattatatcattatggaat
agaaacgcagacgacaccccagtaaccaacagaatccgagaaactcttcgatcggtgctc
caactgcctcagaacacggtactagaatacaaacgacacgatgactgtctcagagatcag
agctcatatcgtcatactactaaaaatatctgcaaatga

DBGET integrated database retrieval system