KEGG   Caenorhabditis elegans (nematode): CELE_C07A12.4Help
Entry
CELE_C07A12.4     CDS       T00019                                 

Gene name
pdi-2
Definition
Protein PDI-2, isoform A
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cel04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(4524211..4524300,4524470..4524853,4525119..4525925,4525976..4526176)
Genome map
AA seq 493 aa AA seqDB search
MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP
EYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDS
IIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPF
GISTEDAVKSEIELKGEGIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQET
ASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEF
FGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDW
DKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAK
MDSTLNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFLETNGKEGAGASEEEK
AEEEADEEGHTEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttccggctcgtcggtctgtttttccttgtcttgggcgcttcggccgccgtcattgaa
gaagaagagaatgtcatcgttcttaccaaggacaacttcgatgaagtgatcaacggaaac
gaattcatcctcgtcgagttctatgccccatggtgcggacactgcaaatccctcgcccca
gaatacgcaaaggccgccactcaactcaaggaagaaggatccgacatcaagctcggaaag
ctcgatgccaccgtccacggagaggtctcctccaagttcgaagtccgcggatacccaact
ctcaagcttttccgcaacggaaagccacaagagtacaacggaggacgcgaccacgactcg
atcatcgcctggttgaagaagaagaccggaccagtcgccaagccactcgctgacgccgat
gccgttaaggagcttcaagagtctgccgatgttgttgtcattggatacttcaaggacacc
acctccgatgatgccaagaccttcctcgaggttgccgccggaatcgatgatgttccattc
ggaatctccaccgaagacgctgtaaagtccgagattgagctcaagggagagggaatcgtt
ctcttcaagaagttcgatgatggacgtgtcgctttcgacgagaagctcacccaagacgga
ctcaagacctggatccaagccaaccgcctcgccctcgtctccgagttcacccaagagact
gcctcagtcatcttcggaggagagatcaagtcgcacaaccttctcttcgtctccaaggaa
tcctctgaattcgccaagctcgagcaagagttcaagaacgccgccaagcaattcaaggga
aaggttctcttcgtctacatcaacaccgacgttgaggagaacgccagaatcatggaattc
ttcggactcaagaaggacgagctcccagccatccgcctcatctccctcgaagaagacatg
accaagttcaagccagacttcgaagagatcaccaccgagaacatctccaagttcacccaa
aactaccttgatggatccgtcaagccacaccttatgtccgaagatatcccagaggattgg
gacaagaacccagtcaagatccttgtcggaaagaacttcgagcaagtcgcccgtgacaac
accaagaacgttcttgttgagttctacgccccatggtgcggacactgcaagcaactcgcc
ccaacctgggacaagctcggagagaagttcgctgacgacgagagcattgtcatcgccaag
atggactcaaccctcaacgaggtcgaggatgtcaagatccaatctttcccaaccatcaag
ttcttcccagctggatccaacaaggtcgtcgactacaccggagaccgtaccattgaagga
ttcacaaagttcctcgagaccaacggaaaggagggagctggagcttccgaggaggagaag
gccgaggaggaggctgatgaggagggacacaccgagctctaa

DBGET integrated database retrieval system