KEGG   Caenorhabditis elegans (nematode): CELE_C07D10.4Help
Entry
CELE_C07D10.4     CDS       T00019                                 

Gene name
nas-7
Definition
Protein NAS-7
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C07D10.4 (nas-7)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C07D10.4 (nas-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(7400725..7400834,7400877..7401057,7401109..7401221,7401515..7401709,7401761..7401882,7401929..7402008,7402066..7402179,7402428..7402507,7402554..7402707))
Genome map
AA seq 382 aa AA seqDB search
MLLPWIITIVTVIPATLGHRNRVQDDEMLVISDSTDSLNLEDFEFADKLTREELFGKHIP
VEVVNDFKSDIRLPRRHKRNGVSRAAKLWPNARIPYAISPHYSPHERALLAKAVKQYHEK
TCIRFVPRQTGEPDYLFIGKVDGCFSEVGRTSGVQVLSLDNGCMEYATIIHEMMHVVGFY
HEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAFSKNGF
PTMLPKVKSATIGNARDFSDVDISKINRMYNCPVEKSVTAPFARARHVPIYSPQYHKYED
RPKIPLRSFDMQQGPINPPMAQIPSQSLVVSSSSGRVNYNSNKPSSQCEDRITVCWWTAD
RCRSPAIYQVMSSLCPKTCKFC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgccatggatcatcactattgtaactgtaatacctgctacattaggtcatagg
aatcgagtacaagatgatgagatgcttgttatatcagatagcacagattcattaaatttg
gaagatttcgaatttgctgataagttaaccagagaggaactgtttggaaaacacattccg
gtggaagtggtaaatgatttcaagtcagatattcggttaccaagacggcacaaaagaaat
ggagtttcccgagcagcgaaactatggccgaacgctagaattccatatgcaatatctcca
cactattctcctcatgaaagagcacttcttgcgaaagctgtgaaacagtaccacgaaaaa
acttgcatcagatttgttccacgacagaccggagagccagattatctttttattggaaaa
gttgatggatgtttctctgaagttggtagaacatcgggagttcaggtgttatctctcgat
aatggatgtatggaatatgcaacaattattcacgaaatgatgcatgttgtcggattttat
catgaacatgaacgatgggatcgcgacaacttcattgatattatctggcaaaatattgat
cgtggagctcttgatcaatttggaaaagttgatttatcgaagacatcgtattacggtcaa
ccatatgattataaatcgattcttcattatgatagtttggcattctcaaaaaacggattc
ccaacaatgttgccgaaagtcaaatctgcaaccatcggaaacgctcgtgacttttctgat
gtggatatttcaaaaatcaaccgaatgtacaattgcccagttgaaaagagtgtgacagct
ccatttgcacgagcacggcacgttccaatatattcaccacaataccataaatatgaagat
cgtccaaagattccacttcgatcatttgatatgcaacaaggtccaattaatccaccaatg
gcacaaataccatcacaaagtcttgttgtttcaagtagctcaggacgggttaattataat
agcaataaaccatcatctcaatgcgaggatcggataactgtatgctggtggacagcagat
cgttgtaggtctcctgcaatttatcaagtcatgtcttcattgtgtccaaaaacatgcaaa
ttttgttag

DBGET integrated database retrieval system