KEGG   Caenorhabditis elegans (nematode): CELE_C07D10.4Help
Entry
CELE_C07D10.4     CDS       T00019                                 

Gene name
nas-7
Definition
Protein NAS-7
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(7400682..7400791,7400834..7401014,7401066..7401178,7401472..7401666,7401718..7401839,7401886..7401965,7402023..7402136,7402385..7402464,7402511..7402664))
Genome map
AA seq 382 aa AA seqDB search
MLLPWIITIVTVIPATLGHRNRVQDDEMLVISDSTDSLNLEDFEFADKLTREELFGKHIP
VEVVNDFKSDIRLPRRHKRNGVSRAAKLWPNARIPYAISPHYSPHERALLAKAVKQYHEK
TCIRFVPRQTGEPDYLFIGKVDGCFSEVGRTSGVQVLSLDNGCMEYATIIHEMMHVVGFY
HEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAFSKNGF
PTMLPKVKSATIGNARDFSDVDISKINRMYNCPVEKSVTAPFARARHVPIYSPQYHKYED
RPKIPLRSFDMQQGPINPPMAQIPSQSLVVSSSSGRVNYNSNKPSSQCEDRITVCWWTAD
RCRSPAIYQVMSSLCPKTCKFC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgccatggatcatcactattgtaactgtaatacctgctacattaggtcatagg
aatcgagtacaagatgatgagatgcttgttatatcagatagcacagattcattaaatttg
gaagatttcgaatttgctgataagttaaccagagaggaactgtttggaaaacacattccg
gtggaagtggtaaatgatttcaagtcagatattcggttaccaagacggcacaaaagaaat
ggagtttcccgagcagcgaaactatggccgaacgctagaattccatatgcaatatctcca
cactattctcctcatgaaagagcacttcttgcgaaagctgtgaaacagtaccacgaaaaa
acttgcatcagatttgttccacgacagaccggagagccagattatctttttattggaaaa
gttgatggatgtttctctgaagttggtagaacatcgggagttcaggtgttatctctcgat
aatggatgtatggaatatgcaacaattattcacgaaatgatgcatgttgtcggattttat
catgaacatgaacgatgggatcgcgacaacttcattgatattatctggcaaaatattgat
cgtggagctcttgatcaatttggaaaagttgatttatcgaagacatcgtattacggtcaa
ccatatgattataaatcgattcttcattatgatagtttggcattctcaaaaaacggattc
ccaacaatgttgccgaaagtcaaatctgcaaccatcggaaacgctcgtgacttttctgat
gtggatatttcaaaaatcaaccgaatgtacaattgcccagttgaaaagagtgtgacagct
ccatttgcacgagcacggcacgttccaatatattcaccacaataccataaatatgaagat
cgtccaaagattccacttcgatcatttgatatgcaacaaggtccaattaatccaccaatg
gcacaaataccatcacaaagtcttgttgtttcaagtagctcaggacgggttaattataat
agcaataaaccatcatctcaatgcgaggatcggataactgtatgctggtggacagcagat
cgttgtaggtctcctgcaatttatcaagtcatgtcttcattgtgtccaaaaacatgcaaa
ttttgttag

DBGET integrated database retrieval system