KEGG   Caenorhabditis elegans (nematode): CELE_C08B11.7Help
Entry
CELE_C08B11.7     CDS       T00019                                 

Gene name
ubh-4
Definition
Protein UBH-4
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_C08B11.7 (ubh-4)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CELE_C08B11.7 (ubh-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(8038380..8038560,8038604..8039254,8039298..8039431))
Genome map
AA seq 321 aa AA seqDB search
MTDAGSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDKAMTRPTYGLIFLFKWRQGD
ETTGIPSDKQNIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNT
RGHCLSNSEEIRTVHNSFSRQTLFELDIKGGESEDNYHFVTYVPIGNKVYELDGLRELPL
EVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNRKQKLQEMMENLIQANENN
ELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQ
AAKEKSKLNTDITKLELKRKQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgctggaagctggtgcttgattgaaagcgatcctggtgtgttcactgaaatg
ctgcgtggtttcggtgttgatgggcttcaagtcgaggagctgtattcgctcgatgatgat
aaagcgatgacacgaccaacttacggactcatttttttgttcaagtggcgccagggagat
gaaacaactgggattcctagtgacaagcaaaacatcttttttgctcatcaaacaattcaa
aacgcttgtgctactcaagctctcatcaacttgcttatgaacgtggaagataccgatgtg
aagcttggaaatatcctgaatcagtacaaagaattcgcgattgacttggatccgaatact
cgcggtcattgtctttcgaacagcgaggaaattcgcactgttcacaatagtttttctcgt
cagactcttttcgaacttgatatcaaaggcggagaatcggaggataactatcactttgtg
acatacgtgccaatcggtaataaggtctacgagctggatgggcttcgtgagctcccactt
gaggttgctgagttccaaaaagaacaagactggattgaggcaattaagcccgtaattcaa
caaagaatgcaaaaatacagcgaaggggagatcacgttcaatttgatggcacttgttcca
aaccgcaaacagaaactgcaggagatgatggagaacttgattcaagcaaatgaaaataat
gagcttgaagagcagatagccgatctcaataaagccattgctgatgaggattacaaaatg
gaaatgtaccgcaaggaaaacaatcgccgacgtcacaattatactccgttcgtaattgaa
ttgatgaagattcttgcaaaggaaggaaaattggttggacttgtcgacaacgcttatcaa
gccgctaaagaaaaatccaagctgaatacagacataaccaagcttgaattgaagagaaaa
caatag

DBGET integrated database retrieval system