KEGG   Caenorhabditis elegans (nematode): CELE_C10C5.6Help
Entry
CELE_C10C5.6      CDS       T00019                                 

Gene name
daf-15
Definition
Protein DAF-15, isoform B
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CELE_C10C5.6 (daf-15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(9386447..9386521,9386586..9386683,9386902..9387123,9387249..9387545,9387595..9387721,9388093..9388462,9388519..9388698,9388742..9389475,9389544..9390406,9390453..9390561,9390993..9391209,9391252..9391431,9391478..9391636,9391686..9392217,9392701..9393012,9393074..9393279,9393680..9393894,9393944..9394272,9394393..9394516)
Genome map
AA seq 1782 aa AA seqDB search
MEEDRSITPFSSFAERLTVNLWHAQRNVERVTLYLQEPRHVEDIAGSMEDEWDCIEECVN
RRKGSDRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLST
QRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEI
WVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRW
QEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFT
SCLTTPIRTSLAFHLSHSEHRDEYPENILDMIPGNLAERRTVLGELNWIFTAITDTIAFT
SIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTM
DMVLDYCRELIYVKECERALFCGRDVINRSNVFPFLVLIDFEHVLTYNETHQYNTFFTEQ
LQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGI
FPYVLKLLQSNISDLKISLAFIWAKILAVDPSCQMELFNECIDESATQQQSPAQSQQPSV
ALKPSSMFANHPPPAQLTMDKRALQINTQTGGRFQTNQNQALDMQLQYAQQQAHQRQMDP
SGGQHSPNAQPRQPQPQQPQQLQQQPSQQQQQQSRQPQGIMKPTNAQPQEKKTMLRFQYF
LQLLGDPEIKPKQKTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVDDTARSVKLL
KLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS
NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFK
LPRKRNSSENLSEQGLDIAAEMPSNHRRPRAPPVNEFMQPSVIRKKMSTSVFSTAVEETV
HEDGIGNVYHIAHEAGNRVEQESEDIEYRERAKVQIKHLEAKTFNEAVAKTWLSLLILSL
DPIERVARMAQKIVHRVEAGMPEMQANIDNTMAHLSRKMIARKNSKATVEMPRKPVGPSE
EVSTLSERIKRNLEVEKVVEMIPESGVSADGIDFTKLNMQKAKEQRKGGKGGQIKKLQDE
SKVKFQVGSPGDVNQQHKNALSPGSSFTDETQSSELFSKDDSSDDDENKSANDEKDRATT
ASGKTVKGAFRKSDIMDAALMEFTPRRTKAVPGDFAVKEESKTLRTVIENPIVSTQFVAW
CSKVFVEPILHVITLDEEKSEDWEHEDEDEFMPEQFREKIKDIQKQDRKMHEEKRARDKK
EGKKEKSQEDVVVTTTTISDWAIHAMEGMLQSADIEGRDFQSCKYDECLWRVKLTHPARS
LTTSKLRRCMYASDGRLMTIIRQDTDTRSFRRFDLTASNPFCPSYVSQLILINDMSREMV
IACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKL
LCTGTRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAV
GYADGRVDYFDMRMANPKAARCNLAPVNMSKQFNDRPPGIMHLRVNRQGFGTELFAGSQD
GSIYKLQLRMFKEATPSIVTPWEYGAHSHMFVHEDSRILASAGGGELAIYDVAQNKLMAR
ILPPGEPNSMRRDKNSSTFGLFSSQRKLSQVQMSGRMSSMSSATVGEDRQPKVISLTMHQ
MRLLTVAGYDDNTVCVYGSPKPGLTGHYENTQGASSPPSQSL
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggataggagtataacaccgttttcctcgtttgcagaacgtttgacagtcaat
ttgtggcatgctcagagaaatgtagaaagagtcacattatatttacaagaaccccgacat
gtcgaagatatcgcaggaagtatggaagatgagtgggattgtattgaagagtgcgtaaat
cgccgaaaaggcagtgatcgcctccgaactgcatctgtcgccatcatcatgtgtctacat
ttgggagtcgatccaccagaagctccgtctcgaaaagatgctccttctcgtcttttatca
tgggttgatccatataaatgtggtgcacacaaagcagccatagagatcggattgagcact
caaagggcttatgaaaagtggcaaccaaaatcaaaaactcgatataaaatttgtacggat
ccgcctatcgatgacgtgagaaaagttgcaacaaatcttcgaagaatcagtggaaatgat
cgagttctgtttcactacaacggacacggtgtaccgaaaccaacagataatggagaaatt
tgggtatttaataaaagcttcacccaatatattccattgtcaatattcgatctacaagga
tggcttgattatcccacaatttatatctgggaaactcattcagctgagacaattcttcat
aactatcgacgatttggagaagatcagaaaatatcctggcaaagtaggtttgatcgatgg
caagaggaacagaggaatctaccaccaatctcatcaaaaatgacagatgctgatcaagca
gaagcattaggttttccagagaaatatcccagatataatgattgtatccatctagcagca
tgcagtgccggtcaatggcttccaatgtcgaatcctcatctgccagctgatctattcact
tcctgtctaaccacgcctatccgaacatcactcgcatttcatttgagtcattcggagcat
cgtgatgagtatccggaaaacattttggacatgattcctggaaatcttgctgaacgaaga
actgtgctcggagagctcaactggatattcactgccatcactgacacaattgcattcact
tcaatagatcgtgactcgttccaaaaacttttccgtcaggatctacttttggcaactctg
ttcagaagtttcttgcttgcacaaagagttatgtcaaagttcaatgttttaccagtttcg
cagcctcctctgaaagacacatcaatgcatgatttatggagatgctgggatcaaacaatg
gatatggttctagactattgtagagaattgatttatgtcaaagaatgcgaaagagcactg
ttttgtggaagagatgttattaatagaagcaatgtgttcccgtttttagtgctcattgac
ttcgaacatgtgctgacttacaatgagacccaccagtacaacacattcttcacagaacaa
ctacaagcttttgaactttggctagactacggtgttgacgaaggaacacctccactccaa
cttccgatggttcttcaagtacttctgagtcaggcacatcgtgtcagagctctacgatta
cttgcacgattccttgattttggtagatgggctatcggatattcacttgccgttggaatc
tttccatatgttctgaagctacttcaaagcaatattagtgatttgaaaatctctttagcg
tttatttgggcaaaaattctggcagtagatccatcgtgtcaaatggaattattcaatgag
tgtatcgatgaatcagcaacacaacaacaatcaccagcacaatcacaacaaccatcagtt
gcattgaaaccatcatccatgtttgcaaatcatccaccacctgcacaattaacaatggat
aaacgtgcacttcagattaatactcaaactggcggaagatttcaaactaatcagaatcag
gcattggatatgcaattacaatatgctcaacaacaagctcatcagaggcaaatggatcca
tcaggaggacaacattcaccaaatgctcagcctagacaaccacaaccacagcaaccacaa
caactacaacagcaaccatcacagcaacaacaacaacaatctagacaaccgcaaggaatt
atgaaaccaacgaatgcacagccacaagaaaagaagacaatgcttcgttttcaatatttc
cttcaacttctcggcgatcctgaaatcaaaccgaaacagaaaactgttgctgcattcgta
cttgctcagctaacatccaataatttcaaactggcacagaaagagctcaccaataaggga
tacatgggaatttgtacggaattgatggtcgatgatactgcgagaagcgtcaaattgctg
aaactgtggattctgattggattgggtcgtctgtggtcagattatgatgtagccagatgg
cagggtattcgattaatggctcatgataaaatgattttggaattgagtgatgaatcagca
gaagttcgtgcagctgctgtatttgcacttggaagcttattgaggaactcttcgagatca
aatgagcatgcatcagcagttgaagaaaatctagcaggagaactatgttcccagtgtgtg
tttgatagttctgttcttgtgagagaagaactgattgttgctcttcaatggtttgtgttt
gatttcgagaaacgattcgtgaaattcttactggaactatcgaatcaaattaagttcaaa
cttccacgaaaacgaaattcttctgaaaatctcagtgaacaaggattggatattgctgca
gaaatgccatcaaatcatcgacgacctcgtgctccaccagtcaacgaattcatgcaacct
tcagttattcgaaagaaaatgtcgacaagtgtgttcagtacagctgttgaagaaactgtg
catgaagacggaataggaaatgtttaccacattgcacatgaagctggaaatcgtgttgaa
caagaatctgaagatattgagtatagagaacgagcaaaagtacagatcaagcacttggaa
gcgaaaacattcaatgaagccgttgctaaaacttggttgtcacttttaatattgtcattg
gatcctattgagagggttgcccgaatggctcaaaaaatagtgcatcgcgtcgaagcagga
atgcccgaaatgcaagccaacattgacaatacaatggctcatctcagtcgaaaaatgatt
gctcgtaaaaattcgaaggcgactgtcgaaatgccacgtaaaccagttggaccgtcagaa
gaagttagcacactttcagaacgaataaaacgaaatttagaagttgaaaaagttgtcgaa
atgattccagagtctggagtctctgccgatggaattgacttcacaaaattaaatatgcaa
aaagcgaaggaacaaagaaaaggaggaaaaggaggacaaatcaagaagttacaggatgaa
tcaaaagtcaaatttcaagttggaagccctggtgatgtaaatcaacaacataaaaacgcg
ttgtctcctggtagttcgttcacagatgaaacacaaagcagtgaacttttttccaaagac
gactcttccgatgacgacgagaacaaatcagccaacgatgagaaggatcgggcaacaact
gcttcaggaaaaactgtcaaaggagcttttcgaaaatcagacatcatggatgcagctttg
atggagttcacaccacgacgaacaaaagcagttcctggagattttgcagtgaaagaagaa
tcaaaaacgttacgaactgtaatagaaaatccaattgtctcaacacaattcgttgcatgg
tgtagtaaagtatttgttgaaccaattcttcatgtaatcacacttgacgaagaaaaatca
gaagattgggaacatgaagatgaggatgaatttatgccagaacaatttcgagaaaaaatc
aaagatattcaaaaacaggatcgtaaaatgcatgaagagaaaagagcaagagacaaaaaa
gaaggaaagaaagagaaaagccaagaggatgtcgttgtcacgacaacaacaatcagtgat
tgggcgattcatgcaatggaaggaatgttgcaaagtgcagatattgagggaagagacttc
cagagttgtaaatatgatgaatgtctctggagagttaagcttactcatcctgctcgatcg
ctaaccacttcaaaactgagaaggtgcatgtatgcatcagatggtcgattgatgacaatt
atccgccaagacacagatactcgttccttccgaagattcgatttgactgcttcaaatcca
ttctgcccatcttatgtatctcaattgattcttattaacgatatgtcacgagaaatggtt
atcgcgtgtagtacaaatggtgtagttcgaatctgggatccatattttctcggatggtgt
gatgactatgaaaagcctccagaactcgtatcagcatcatttccactggaatcacaaatg
aaaattagtgatgaaacgaatcgatgcctctttgattggaatcagcaaaacggaaagctt
ctgtgtaccggcacaagaagtgtcagaatttgggatgcacactgtgagaaagtatgtcac
gatgtgatgtattctccaggaagtaaacaacagacaggaccaggagcaaaactcaataca
aatactttaccgacagcaatgtctggaaatctggatgaagaaggaaatatggttgcagtc
ggttatgctgatggtcgagtcgactattttgatatgcgaatggctaatccaaaagctgca
cgttgtaatcttgctcctgtaaatatgtcaaaacagtttaatgatcgaccacctggaatt
atgcatttgagagttaatagacaaggttttggtactgaattatttgctggaagtcaagat
ggaagtatctacaagttacaacttagaatgtttaaggaagcaactccatcaatcgttact
ccttgggaatacggagctcattctcatatgtttgttcacgaagattcccgaattcttgca
agtgctggtggtggagaattagcaatctacgacgttgctcaaaataagctaatggctcgt
atcttaccacccggagagcccaattcaatgaggagagataaaaattcaagcacatttgga
ttgttcagctcacaaaggaaactatcacaagttcaaatgagtggaagaatgtcatcgatg
tcttcagcaacagttggagaagatcgacaaccaaaagttatttcattgacaatgcatcaa
atgagactgctcactgtcgctggatacgatgacaatacagtttgtgtatatggatccccg
aaacccggacttacaggccactacgaaaacacccaaggcgccagttcccctccctcccaa
tcactgtaa

DBGET integrated database retrieval system