KEGG   Caenorhabditis elegans (nematode): CELE_C10C5.6Help
Entry
CELE_C10C5.6      CDS       T00019                                 

Gene name
daf-15
Definition
(RefSeq) Uncharacterized protein
  KO
K07204  
regulatory associated protein of mTOR
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CELE_C10C5.6 (daf-15)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CELE_C10C5.6 (daf-15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(9386208..9386272,9386457..9386538,9386603..9386700,9386919..9387140,9387266..9387562,9387612..9387738,9388110..9388479,9388536..9388715,9388759..9389492,9389561..9390423,9390470..9390578,9391010..9391226,9391287..9391448,9391495..9391653,9391703..9392234,9392718..9393029,9393091..9393296,9393697..9393911,9393961..9394289,9394410..9394533)
Genome map
AA seq 1800 aa AA seqDB search
MRQKVQRSALARITSSLNSLPTHKMEEDRSITPFSSFAERLTVNLWHAQRNVERVTLYLQ
EPRHVEDIAGSMEDEWDCIEECVNRRKGSDRLRTASVAIIMCLHLGVDPPEAPSRKDAPS
RLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRI
SGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAE
TILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCI
HLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYPENILDMIPGNL
AERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNV
LPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKECERALFCGRDVINRSNVFPFL
VLIDFEHVLTYNETHQYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVR
ALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILAVDPSCQME
LFNECIDESATQQQSPAQSQQPSVALKPSSMFANHPPPAQLTMDKRALQINTQTGGRFQT
NQNQALDMQLQYAQQQAHQRQMDPSGGQHSPNAQPRQPQPQQPQQLQQQPSQQQQQQSRQ
PQGIMKPTNAQPQEKKTMLRFQYFLQLLGDPEIKPKQKTVAAFVLAQLTSNNFKLAQKEL
TNKGYMGICTELMVDDTARSVKLLKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELS
DESAEVRAAAVFALGSLLRNSSRSNEHASAVEENLAGELCSQCVFDSSVLVREELIVALQ
WFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRRPRAPPVNE
FMQPSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEAGNRVEQESEDIEYRERAKVQI
KHLEAKTFNEAVAKTWLSLLILSLDPIERVARMAQKIVHRVEAGMPEMQANIDNTMAHLS
RKMIARKNSKATVEMPRKPVGPSEEVSTLSERIKRNLEVEKESGVSADGIDFTKLNMQKA
KEQRKGGKGGQIKKLQDESKVKFQVGSPGDVNQQHKNALSPGSSFTDETQSSELFSKDDS
SDDDENKSANDEKDRATTASGKTVKGAFRKSDIMDAALMEFTPRRTKAVPGDFAVKEESK
TLRTVIENPIVSTQFVAWCSKVFVEPILHVITLDEEKSEDWEHEDEDEFMPEQFREKIKD
IQKQDRKMHEEKRARDKKEGKKEKSQEDVVVTTTTISDWAIHAMEGMLQSADIEGRDFQS
CKYDECLWRVKLTHPARSLTTSKLRRCMYASDGRLMTIIRQDTDTRSFRRFDLTASNPFC
PSYVSQLILINDMSREMVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKI
SDETNRCLFDWNQQNGKLLCTGTRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNT
LPTAMSGNLDEEGNMVAVGYADGRVDYFDMRMANPKAARCNLAPVNMSKQFNDRPPGIMH
LRVNRQGFGTELFAGSQDGSIYKLQLRMFKEATPSIVTPWEYGAHSHMFVHEDSRILASA
GGGELAIYDVAQNKLMARILPPGEPNSMRRDKNSSTFGLFSSQRKLSQVQMSGRMSSMSS
ATVGEDRQPKVISLTMHQMRLLTVAGYDDNTVCVYGSPKPGLTGHYENTQGASSPPSQSL
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaaagtgcaacggagcgcacttgcacgaatcacgtcttctttaaattcattg
ccaacacacaaaatggaagaggataggagtataacaccgttttcctcgtttgcagaacgt
ttgacagtcaatttgtggcatgctcagagaaatgtagaaagagtcacattatatttacaa
gaaccccgacatgtcgaagatatcgcaggaagtatggaagatgagtgggattgtattgaa
gagtgcgtaaatcgccgaaaaggcagtgatcgcctccgaactgcatctgtcgccatcatc
atgtgtctacatttgggagtcgatccaccagaagctccgtctcgaaaagatgctccttct
cgtcttttatcatgggttgatccatataaatgtggtgcacacaaagcagccatagagatc
ggattgagcactcaaagggcttatgaaaagtggcaaccaaaatcaaaaactcgatataaa
atttgtacggatccgcctatcgatgacgtgagaaaagttgcaacaaatcttcgaagaatc
agtggaaatgatcgagttctgtttcactacaacggacacggtgtaccgaaaccaacagat
aatggagaaatttgggtatttaataaaagcttcacccaatatattccattgtcaatattc
gatctacaaggatggcttgattatcccacaatttatatctgggaaactcattcagctgag
acaattcttcataactatcgacgatttggagaagatcagaaaatatcctggcaaagtagg
tttgatcgatggcaagaggaacagaggaatctaccaccaatctcatcaaaaatgacagat
gctgatcaagcagaagcattaggttttccagagaaatatcccagatataatgattgtatc
catctagcagcatgcagtgccggtcaatggcttccaatgtcgaatcctcatctgccagct
gatctattcacttcctgtctaaccacgcctatccgaacatcactcgcatttcatttgagt
cattcggagcatcgtgatgagtatccggaaaacattttggacatgattcctggaaatctt
gctgaacgaagaactgtgctcggagagctcaactggatattcactgccatcactgacaca
attgcattcacttcaatagatcgtgactcgttccaaaaacttttccgtcaggatctactt
ttggcaactctgttcagaagtttcttgcttgcacaaagagttatgtcaaagttcaatgtt
ttaccagtttcgcagcctcctctgaaagacacatcaatgcatgatttatggagatgctgg
gatcaaacaatggatatggttctagactattgtagagaattgatttatgtcaaagaatgc
gaaagagcactgttttgtggaagagatgttattaatagaagcaatgtgttcccgttttta
gtgctcattgacttcgaacatgtgctgacttacaatgagacccaccagtacaacacattc
ttcacagaacaactacaagcttttgaactttggctagactacggtgttgacgaaggaaca
cctccactccaacttccgatggttcttcaagtacttctgagtcaggcacatcgtgtcaga
gctctacgattacttgcacgattccttgattttggtagatgggctatcggatattcactt
gccgttggaatctttccatatgttctgaagctacttcaaagcaatattagtgatttgaaa
atctctttagcgtttatttgggcaaaaattctggcagtagatccatcgtgtcaaatggaa
ttattcaatgagtgtatcgatgaatcagcaacacaacaacaatcaccagcacaatcacaa
caaccatcagttgcattgaaaccatcatccatgtttgcaaatcatccaccacctgcacaa
ttaacaatggataaacgtgcacttcagattaatactcaaactggcggaagatttcaaact
aatcagaatcaggcattggatatgcaattacaatatgctcaacaacaagctcatcagagg
caaatggatccatcaggaggacaacattcaccaaatgctcagcctagacaaccacaacca
cagcaaccacaacaactacaacagcaaccatcacagcaacaacaacaacaatctagacaa
ccgcaaggaattatgaaaccaacgaatgcacagccacaagaaaagaagacaatgcttcgt
tttcaatatttccttcaacttctcggcgatcctgaaatcaaaccgaaacagaaaactgtt
gctgcattcgtacttgctcagctaacatccaataatttcaaactggcacagaaagagctc
accaataagggatacatgggaatttgtacggaattgatggtcgatgatactgcgagaagc
gtcaaattgctgaaactgtggattctgattggattgggtcgtctgtggtcagattatgat
gtagccagatggcagggtattcgattaatggctcatgataaaatgattttggaattgagt
gatgaatcagcagaagttcgtgcagctgctgtatttgcacttggaagcttattgaggaac
tcttcgagatcaaatgagcatgcatcagcagttgaagaaaatctagcaggagaactatgt
tcccagtgtgtgtttgatagttctgttcttgtgagagaagaactgattgttgctcttcaa
tggtttgtgtttgatttcgagaaacgattcgtgaaattcttactggaactatcgaatcaa
attaagttcaaacttccacgaaaacgaaattcttctgaaaatctcagtgaacaaggattg
gatattgctgcagaaatgccatcaaatcatcgacgacctcgtgctccaccagtcaacgaa
ttcatgcaaccttcagttattcgaaagaaaatgtcgacaagtgtgttcagtacagctgtt
gaagaaactgtgcatgaagacggaataggaaatgtttaccacattgcacatgaagctgga
aatcgtgttgaacaagaatctgaagatattgagtatagagaacgagcaaaagtacagatc
aagcacttggaagcgaaaacattcaatgaagccgttgctaaaacttggttgtcactttta
atattgtcattggatcctattgagagggttgcccgaatggctcaaaaaatagtgcatcgc
gtcgaagcaggaatgcccgaaatgcaagccaacattgacaatacaatggctcatctcagt
cgaaaaatgattgctcgtaaaaattcgaaggcgactgtcgaaatgccacgtaaaccagtt
ggaccgtcagaagaagttagcacactttcagaacgaataaaacgaaatttagaagttgaa
aaagagtctggagtctctgccgatggaattgacttcacaaaattaaatatgcaaaaagcg
aaggaacaaagaaaaggaggaaaaggaggacaaatcaagaagttacaggatgaatcaaaa
gtcaaatttcaagttggaagccctggtgatgtaaatcaacaacataaaaacgcgttgtct
cctggtagttcgttcacagatgaaacacaaagcagtgaacttttttccaaagacgactct
tccgatgacgacgagaacaaatcagccaacgatgagaaggatcgggcaacaactgcttca
ggaaaaactgtcaaaggagcttttcgaaaatcagacatcatggatgcagctttgatggag
ttcacaccacgacgaacaaaagcagttcctggagattttgcagtgaaagaagaatcaaaa
acgttacgaactgtaatagaaaatccaattgtctcaacacaattcgttgcatggtgtagt
aaagtatttgttgaaccaattcttcatgtaatcacacttgacgaagaaaaatcagaagat
tgggaacatgaagatgaggatgaatttatgccagaacaatttcgagaaaaaatcaaagat
attcaaaaacaggatcgtaaaatgcatgaagagaaaagagcaagagacaaaaaagaagga
aagaaagagaaaagccaagaggatgtcgttgtcacgacaacaacaatcagtgattgggcg
attcatgcaatggaaggaatgttgcaaagtgcagatattgagggaagagacttccagagt
tgtaaatatgatgaatgtctctggagagttaagcttactcatcctgctcgatcgctaacc
acttcaaaactgagaaggtgcatgtatgcatcagatggtcgattgatgacaattatccgc
caagacacagatactcgttccttccgaagattcgatttgactgcttcaaatccattctgc
ccatcttatgtatctcaattgattcttattaacgatatgtcacgagaaatggttatcgcg
tgtagtacaaatggtgtagttcgaatctgggatccatattttctcggatggtgtgatgac
tatgaaaagcctccagaactcgtatcagcatcatttccactggaatcacaaatgaaaatt
agtgatgaaacgaatcgatgcctctttgattggaatcagcaaaacggaaagcttctgtgt
accggcacaagaagtgtcagaatttgggatgcacactgtgagaaagtatgtcacgatgtg
atgtattctccaggaagtaaacaacagacaggaccaggagcaaaactcaatacaaatact
ttaccgacagcaatgtctggaaatctggatgaagaaggaaatatggttgcagtcggttat
gctgatggtcgagtcgactattttgatatgcgaatggctaatccaaaagctgcacgttgt
aatcttgctcctgtaaatatgtcaaaacagtttaatgatcgaccacctggaattatgcat
ttgagagttaatagacaaggttttggtactgaattatttgctggaagtcaagatggaagt
atctacaagttacaacttagaatgtttaaggaagcaactccatcaatcgttactccttgg
gaatacggagctcattctcatatgtttgttcacgaagattcccgaattcttgcaagtgct
ggtggtggagaattagcaatctacgacgttgctcaaaataagctaatggctcgtatctta
ccacccggagagcccaattcaatgaggagagataaaaattcaagcacatttggattgttc
agctcacaaaggaaactatcacaagttcaaatgagtggaagaatgtcatcgatgtcttca
gcaacagttggagaagatcgacaaccaaaagttatttcattgacaatgcatcaaatgaga
ctgctcactgtcgctggatacgatgacaatacagtttgtgtatatggatccccgaaaccc
ggacttacaggccactacgaaaacacccaaggcgccagttcccctccctcccaatcactg
taa

DBGET integrated database retrieval system