KEGG   Caenorhabditis elegans (nematode): CELE_C10F3.5Help
Entry
CELE_C10F3.5      CDS       T00019                                 

Gene name
pcm-1
Definition
Protein PCM-1, isoform B
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CELE_C10F3.5 (pcm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(5960710..5960817,5960870..5960935,5961827..5961910,5962622..5962744,5962798..5962902,5963101..5963219,5963650..5963704))
Genome map
AA seq 219 aa AA seqDB search
MAWRSSGSTNSELIDNLRNNRVFASQRAYDAMKSVDRGDFAPRAPYEDAPQRIGYNATHA
AALDYLQNHLVAGAKALDVGSGSGYLTVCMAMMVGRNGTVVGIEHMPQLVELSEKNIRKH
HSEQLERGNVIIIEGDGRQGFAEKAPYNAIHVGAASKGVPKALTDQLAEGGRMMIPVEQV
DGNQVFMQIDKINGKIEQKIVEHVIYVPLTSREEQWNRN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcatggagatccagtggttcgactaattcggagctcatcgataatttgagaaataat
cgagtgtttgccagtcaaagagcctacgatgcgatgaaatccgttgatcgtggagatttt
gctccgagagctccttatgaagacgctcctcaacgaattggatataatgcaacgcacgca
gctgctctcgactacctacaaaaccacctggttgccggtgccaaagctcttgacgttggc
tcaggaagtggatatttgacagtttgtatggcaatgatggttggccgaaatggcacggtt
gttggaattgaacatatgccacagctggtcgaattaagcgagaaaaatatcagaaagcat
cacagtgaacaattggaacgtggaaatgttatcattattgagggagacggtcgtcaagga
ttcgcggaaaaggctccatacaatgcaattcacgtgggagcagcttcaaaaggagtcccc
aaagcgctcacggatcaactggctgaaggtggcagaatgatgattccggttgaacaagtc
gacggaaatcaggtcttcatgcaaatcgataagatcaatggaaaaattgagcaaaagatt
gtggaacacgtgatctacgtgccattgacaagtcgcgaagaacaatggaaccgcaattaa

DBGET integrated database retrieval system