KEGG   Caenorhabditis elegans (nematode): CELE_C11E4.1Help
Entry
CELE_C11E4.1      CDS       T00019                                 

Gene name
gpx-5
Definition
Protein GPX-5
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_C11E4.1 (gpx-5)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_C11E4.1 (gpx-5)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CELE_C11E4.1 (gpx-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(9584695..9584752,9584850..9584923,9584973..9585057,9585476..9585720,9585928..9586137)
Genome map
AA seq 223 aa AA seqDB search
MALWQLTFAALFAFVAAQPGPKMVDETTRWSQCKDTNQSIYDFQVETLQGEYTDLSQYRG
QVLLMVNVATFCAYTQQYTDFNPLIEKYQSQGFTLIAFPCNQFYLQEPAENHELMNGIMY
VRPGNGWKPHQNLHIYGKLDTNGDNQHPIYEFVKESCPQTVDKIGKTDELMYNPIRASDI
TWNFEKFLIDRNGQPRFRFHPTAWSHGDVVTPFIEQLLAEPAN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggcagctcacatttgcggctctttttgcgttcgtcgctgctcagccagga
ccgaaaatggttgacgaaacgactcgctggagtcaatgtaaagacacaaaccaatctatt
tacgatttccaggtagaaacactacaaggagaatacacagaccttagtcaataccgtgga
caggtgcttctcatggtcaacgttgctactttttgcgcgtacacccagcaatacacggat
ttcaacccccttatcgagaagtaccaatcccaaggatttactctcattgccttcccatgc
aatcaattctatttgcaagagccagctgagaaccatgaactgatgaatggaataatgtat
gttcgtcctggaaacggatggaagccacaccagaacttgcacatttatggaaagcttgac
accaacggagacaaccaacacccaatctacgagtttgtcaaggagtcttgcccacaaact
gttgacaaaattggaaagactgatgaattgatgtacaacccaattcgtgcttctgatatc
acatggaacttcgagaagttccttattgacagaaatggacaaccaagattccgcttccac
ccaactgcttggagccacggagatgttgtcactccattcattgagcaactccttgctgag
ccagctaattaa

DBGET integrated database retrieval system