KEGG   Caenorhabditis elegans (nematode): CELE_C11E4.1Help
Entry
CELE_C11E4.1      CDS       T00019                                 

Gene name
C11E4.1
Definition
Protein C11E4.1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cel00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cel00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(9584638..9584695,9584793..9584866,9584916..9585000,9585419..9585663,9585871..9586080)
Genome map
AA seq 223 aa AA seqDB search
MALWQLTFAALFAFVAAQPGPKMVDETTRWSQCKDTNQSIYDFQVETLQGEYTDLSQYRG
QVLLMVNVATFCAYTQQYTDFNPLIEKYQSQGFTLIAFPCNQFYLQEPAENHELMNGIMY
VRPGNGWKPHQNLHIYGKLDTNGDNQHPIYEFVKESCPQTVDKIGKTDELMYNPIRASDI
TWNFEKFLIDRNGQPRFRFHPTAWSHGDVVTPFIEQLLAEPAN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggcagctcacatttgcggctctttttgcgttcgtcgctgctcagccagga
ccgaaaatggttgacgaaacgactcgctggagtcaatgtaaagacacaaaccaatctatt
tacgatttccaggtagaaacactacaaggagaatacacagaccttagtcaataccgtgga
caggtgcttctcatggtcaacgttgctactttttgcgcgtacacccagcaatacacggat
ttcaacccccttatcgagaagtaccaatcccaaggatttactctcattgccttcccatgc
aatcaattctatttgcaagagccagctgagaaccatgaactgatgaatggaataatgtat
gttcgtcctggaaacggatggaagccacaccagaacttgcacatttatggaaagcttgac
accaacggagacaaccaacacccaatctacgagtttgtcaaggagtcttgcccacaaact
gttgacaaaattggaaagactgatgaattgatgtacaacccaattcgtgcttctgatatc
acatggaacttcgagaagttccttattgacagaaatggacaaccaagattccgcttccac
ccaactgcttggagccacggagatgttgtcactccattcattgagcaactccttgctgag
ccagctaattaa

DBGET integrated database retrieval system