KEGG   Caenorhabditis elegans (nematode): CELE_C11E4.2Help
Entry
CELE_C11E4.2      CDS       T00019                                 

Gene name
gpx-3
Definition
Protein GPX-3
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_C11E4.2 (gpx-3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CELE_C11E4.2 (gpx-3)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CELE_C11E4.2 (gpx-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(9587958..9588021,9588066..9588221,9588268..9588512,9588564..9588773)
Genome map
AA seq 224 aa AA seqDB search
MAPGSVLSLAVALATIIGISCTATVDETMRWKECLNTNQSIFDFQIETLQGEYTDLSQYR
GKVILLVNVATFCAYTQQYTDFNPMLEKYQAQGLTLVAFPCNQFYLQEPAENHELMNGLT
YVRPGNGWTPHQELHIYGKIDVNGDNHHPLYEFVKESCPQTVDKIGKTDELMYNPVRPSD
ITWNFEKFLIDRNGQPRFRFHPTAWSHGDVVTPFIEQLLAEPAN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcacctggttcagtactttctttggctgttgccctggcaactattattggtatctct
tgcactgcaacggttgatgaaacaatgcgttggaaagaatgtttgaatacaaatcaaagc
atattcgactttcaaattgaaactttgcaaggagaatacacagatcttagtcagtaccga
ggaaaagtaattcttctcgtcaatgttgcaacattctgtgcatacactcaacagtacact
gacttcaaccccatgcttgaaaaatatcaagctcaggggcttacgcttgttgccttccca
tgcaatcagttctacctgcaagagccagcagagaaccacgagcttatgaacgggcttacc
tatgtgcgccctggaaatggatggactccacatcaagagcttcatatctatggtaaaatt
gatgtgaacggagacaatcatcacccactttacgagtttgttaaggagtcttgcccacaa
actgttgacaaaattggaaaaactgacgagttgatgtacaaccctgttcggccatccgat
atcacatggaactttgagaagttccttattgacagaaatggacaaccaagattccgcttc
cacccaaccgcttggagccacggagatgttgtcactccattcattgagcaactccttgct
gagccagctaattaa

DBGET integrated database retrieval system