KEGG   Caenorhabditis elegans (nematode): CELE_C12D8.5Help
Entry
CELE_C12D8.5      CDS       T00019                                 

Gene name
daf-36
Definition
Protein DAF-36
Orthology
K14938  
cholesterol 7-dehydrogenase [EC:1.3.1.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CELE_C12D8.5 (daf-36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(10223556..10223646,10223692..10223954,10224145..10224675,10224725..10224822,10225310..10225460,10225507..10225659))
Genome map
AA seq 428 aa AA seqDB search
MLLEQIWGFLTAHPISVVTTILIVYLIHITLKPLNRVRRLGDVGLFFGKPELKGFYRERQ
LERLKLLRRVGDMPPVFPNGWYCVCESEKLANNQIMEITVLGQFLSLIRSESGAVYITDS
YCPHIGANFNIGGRVVRDNCIQCPFHGWIFSAETGKCVEVPYDEGRIPEQAKVTTWPCIE
RNNNIYLWYHCDGAEPEWEIPEITEITDGFWHLGGRTEHEVMCHIQEIPENGADIAHLNY
LHKSAPPVTKGSDIIKTDLSDPQPAVQHVWDGKWEVKSEEDRHCGVMHLNQFMTFWGYKV
PLTSSKLVAEQHGPGIVHMLFDFGIWGKGVVFQTVTPEEALLQRVRFRIFSNIPWFFVKF
FMTVEAMQFERDVFIWSNKKYIKSPLLVKNDGPIQKHRRWFSQFYTENSPKMLKDGSLSN
QAKSIFDW
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctactggaacagatttggggttttttaacggctcatccaatatctgttgttactact
attctgatagtttatcttattcatattactttaaaaccattgaatcgagtcaggagactt
ggcgatgttggattgtttttcggaaaaccagagctgaaaggattttacagagaacgtcaa
ttggagagattgaagcttttaagaagagttggagatatgcctccagtttttcccaatgga
tggtattgtgtttgtgaatctgagaagttagcgaacaatcaaataatggaaatcacagtt
ttagggcaatttctatcactgataagatctgagtcgggcgccgtctatatcacagactca
tattgcccgcacattggagcgaattttaatattggaggacgggtagtacgtgacaattgc
attcaatgcccatttcatggatggatttttagtgcagaaactggaaaatgtgttgaagtt
ccgtatgatgaaggaagaattccagagcaagcaaaagtgacaacatggccatgtatagaa
agaaataataatatttatctgtggtatcattgtgatggagcagaaccagaatgggaaatt
ccggagatcacagagattactgatggcttctggcatttgggaggaagaactgagcatgag
gttatgtgccatattcaagaaattccggagaacggagcagacattgcacatctgaattat
cttcacaaatcggctccacctgttaccaaaggatcagatattataaaaacagatctatca
gatccccagccagctgttcaacatgtttgggatggaaaatgggaagtgaaatcagaggag
gatagacattgtggagttatgcatttgaatcaatttatgactttttggggatataaagtt
ccattaaccagcagtaaacttgttgcagagcagcatggtcctggaattgtccacatgttg
tttgattttggaatttgggggaaaggagtcgtatttcaaacagtaactcccgaagaagca
cttctccagagagttcgattcagaatattttcaaatattccatggttctttgtgaaattc
ttcatgacagtggaagcaatgcaatttgaacgagatgtgtttatttggtccaacaaaaag
tatataaaatctccattgctggtaaagaacgatggaccgattcagaaacatcgaagatgg
ttttctcaattctacacggaaaatagtccaaaaatgctgaaagatggaagtttgtccaat
caagcaaaatcaatttttgactggtaa

DBGET integrated database retrieval system