KEGG   Caenorhabditis elegans (nematode): CELE_C13B4.2Help
Entry
CELE_C13B4.2      CDS       T00019                                 

Gene name
usp-14
Definition
Protein USP-14
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(14485762..14486046,14487002..14487661,14488037..14488349,14488396..14488607))
Genome map
AA seq 489 aa AA seqDB search
MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI
KENMTIMMMGSVGEIPKPPTVLEKKQANRDKQAEEISALYPCGLANLGNTCYFNSCVQML
KEVNELVLKPAEEMRIREHNDRLCHNLATLFNSLRDKDRALRSKGEPIKPFAAILTLSDS
FPQFEKFKQQDANECLVSIMSNVTRIYGLSGWNIESLFRIQTETTMKCLESDEVSEKKVE
RNNQLTCYVNQDVRFLQTGIKAGFEEEMTRNSEELNRDAKWQKNTQISRLPKYLTVNINR
FFYKESTKTNAKILKSVQFPMQLDTYDLCSQELKDKLVARRADIKLEEDAKLERELRKKV
LDKEQGDKIFDDGVALPTAFEDDAGSNNSGFYDLKGIITHKGRSSQDGHYVAWMRSSEDG
KWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLYEARVIKQFPELPPAPVPTEVAADTA
EPMEVSEKQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgtcaatgttaaatggcaaaaggagaaatatgttgtggaagtcgacacctca
gcacctccgatggtgttcaaagcgcaacttttcgctttaacacaggtggtacctgaacgg
cagaaggtagtgattatgggacgcacactgggcgatgatgactgggaaggaatcactatc
aaggagaatatgacgattatgatgatgggatctgttggtgaaattccgaagcctcccact
gtgctcgaaaagaaacaagcaaaccgggataaacaagccgaagagatttcagcgctctat
ccatgtgggctcgctaatctcggaaacacgtgttatttcaactcgtgtgtgcaaatgctc
aaagaagtcaacgagctggttctgaagcctgccgaggagatgagaatccgtgagcataat
gatcgtctgtgccataatcttgctacactcttcaatagtcttcgcgataaggatagagct
cttcgcagcaagggagagccgatcaagccgttcgcagcgattcttactctctccgacagt
tttcctcaattcgaaaagttcaaacaacaggatgccaacgaatgtctcgtatcgatcatg
agcaacgtcacgagaatttatggattgtccgggtggaatattgaatcacttttccgaatc
cagacagagaccacgatgaagtgtctggaaagtgacgaagtttctgagaaaaaagtggag
cggaacaatcagttgacttgctatgtgaatcaagacgttcgatttttgcaaactggaatt
aaagctggatttgaagaggaaatgacgagaaatagtgaagaacttaatagagatgcgaaa
tggcagaaaaatactcaaatctcgcgtcttccaaaatacctcactgtgaatatcaatcga
ttcttctacaaggaaagcaccaagaccaacgcgaaaattctgaaatccgtccaattcccc
atgcaattagacacctatgacttgtgcagtcaggaactcaaggataaacttgttgctcga
cgagctgatatcaaattggaggaggatgcgaagctggagcgagagctgaggaagaaggtg
ttggacaaagagcaaggcgataagattttcgatgatggagttgctctgcctaccgctttc
gaagatgatgcaggatcgaacaactctggattttatgatctcaagggaatcatcacccac
aaaggccgatcctctcaagatggtcactacgtcgcctggatgcgatcatctgaagacggc
aagtggcgtctttttgacgatgagcatgtcactgttgtcgacgaggaagccattctgaaa
acgtctggaggtggtgattggcacagtgcctacgttcttctctacgaggcccgtgtcatc
aagcaattccctgaacttccaccagcaccagtaccgactgaagttgccgctgatactgct
gagccaatggaagtatcggagaagcaataa

DBGET integrated database retrieval system