KEGG   Caenorhabditis elegans (nematode): CELE_C13B4.2Help
Entry
CELE_C13B4.2      CDS       T00019                                 

Gene name
usp-14
Definition
Protein USP-14
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CELE_C13B4.2 (usp-14)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CELE_C13B4.2 (usp-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(14485837..14486121,14487077..14487736,14488112..14488424,14488471..14488682))
Genome map
AA seq 489 aa AA seqDB search
MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI
KENMTIMMMGSVGEIPKPPTVLEKKQANRDKQAEEISALYPCGLANLGNTCYFNSCVQML
KEVNELVLKPAEEMRIREHNDRLCHNLATLFNSLRDKDRALRSKGEPIKPFAAILTLSDS
FPQFEKFKQQDANECLVSIMSNVTRIYGLSGWNIESLFRIQTETTMKCLESDEVSEKKVE
RNNQLTCYVNQDVRFLQTGIKAGFEEEMTRNSEELNRDAKWQKNTQISRLPKYLTVNINR
FFYKESTKTNAKILKSVQFPMQLDTYDLCSQELKDKLVARRADIKLEEDAKLERELRKKV
LDKEQGDKIFDDGVALPTAFEDDAGSNNSGFYDLKGIITHKGRSSQDGHYVAWMRSSEDG
KWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLYEARVIKQFPELPPAPVPTEVAADTA
EPMEVSEKQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgtcaatgttaaatggcaaaaggagaaatatgttgtggaagtcgacacctca
gcacctccgatggtgttcaaagcgcaacttttcgctttaacacaggtggtacctgaacgg
cagaaggtagtgattatgggacgcacactgggcgatgatgactgggaaggaatcactatc
aaggagaatatgacgattatgatgatgggatctgttggtgaaattccgaagcctcccact
gtgctcgaaaagaaacaagcaaaccgggataaacaagccgaagagatttcagcgctctat
ccatgtgggctcgctaatctcggaaacacgtgttatttcaactcgtgtgtgcaaatgctc
aaagaagtcaacgagctggttctgaagcctgccgaggagatgagaatccgtgagcataat
gatcgtctgtgccataatcttgctacactcttcaatagtcttcgcgataaggatagagct
cttcgcagcaagggagagccgatcaagccgttcgcagcgattcttactctctccgacagt
tttcctcaattcgaaaagttcaaacaacaggatgccaacgaatgtctcgtatcgatcatg
agcaacgtcacgagaatttatggattgtccgggtggaatattgaatcacttttccgaatc
cagacagagaccacgatgaagtgtctggaaagtgacgaagtttctgagaaaaaagtggag
cggaacaatcagttgacttgctatgtgaatcaagacgttcgatttttgcaaactggaatt
aaagctggatttgaagaggaaatgacgagaaatagtgaagaacttaatagagatgcgaaa
tggcagaaaaatactcaaatctcgcgtcttccaaaatacctcactgtgaatatcaatcga
ttcttctacaaggaaagcaccaagaccaacgcgaaaattctgaaatccgtccaattcccc
atgcaattagacacctatgacttgtgcagtcaggaactcaaggataaacttgttgctcga
cgagctgatatcaaattggaggaggatgcgaagctggagcgagagctgaggaagaaggtg
ttggacaaagagcaaggcgataagattttcgatgatggagttgctctgcctaccgctttc
gaagatgatgcaggatcgaacaactctggattttatgatctcaagggaatcatcacccac
aaaggccgatcctctcaagatggtcactacgtcgcctggatgcgatcatctgaagacggc
aagtggcgtctttttgacgatgagcatgtcactgttgtcgacgaggaagccattctgaaa
acgtctggaggtggtgattggcacagtgcctacgttcttctctacgaggcccgtgtcatc
aagcaattccctgaacttccaccagcaccagtaccgactgaagttgccgctgatactgct
gagccaatggaagtatcggagaagcaataa

DBGET integrated database retrieval system