KEGG   Caenorhabditis elegans (nematode): CELE_C14B1.1Help
Entry
CELE_C14B1.1      CDS       T00019                                 

Gene name
pdi-1
Definition
Protein PDI-1
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_C14B1.1 (pdi-1)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_C14B1.1 (pdi-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CELE_C14B1.1 (pdi-1)
  Exosomal proteins of colorectal cancer cells
   CELE_C14B1.1 (pdi-1)
  Exosomal proteins of bladder cancer cells
   CELE_C14B1.1 (pdi-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:complement(join(3699852..3700028,3700079..3700885,3700936..3701319,3701366..3701455))
Genome map
AA seq 485 aa AA seqDB search
MSLSVSFIFLLVASIGAVVADSENVLVLTESNFEETINGNEFVLVKFYAPWCVHCKSLAP
KYDEAADLLKEEGSDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQ
IVDWVKKKSGPTVTTVESVEQLEELKGKTRVVVLGYFKDAKSDAATIYNEVADSVDDAFF
AVAGSAEVAAAASLNEDGVALIRTDGDDSETSTIAEAEITNTIALKQWLHAYKLSAVTEF
THESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDVDVEENAR
ILEFLGVDAKNTPANRIVSLADQVEKFKPQEGEDFEAFTNSYLEGKSAQDLKAQDLPEDW
NALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAK
LDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFVNKYAGSASESETASQ
DHEEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgtcagtgtcctttatcttcctcctggtcgcatcaatcggagcagttgttgct
gacagcgaaaacgtgcttgttctcactgaaagcaatttcgaagaaactatcaatggaaat
gagtttgttctagtcaaattctatgctccatggtgtgtacattgcaagtctcttgctcca
aagtacgacgaagccgccgatttgctgaaggaggaaggatccgatatcaagctcgccaag
gttgacgccaccgaaaaccaagctcttgcatccaagttcgaggtccgtggatatccaact
atcctctacttcaagagtggaaagccaacgaaatacaccggaggacgcgccaccgctcaa
attgtcgattgggtcaagaagaagagtggaccaactgttaccactgttgagtcagttgag
caactcgaggaattgaagggaaagaccagagttgttgttcttggatacttcaaggacgcg
aaatctgatgctgctaccatctacaacgaagttgctgattctgtcgatgacgcattcttc
gccgttgccggttctgctgaggttgctgctgccgcatctttgaatgaagatggagtcgct
cttatccgcactgatggagacgacagcgagactagcacaattgctgaagctgaaatcacc
aacaccatcgctcttaagcaatggctccacgcttacaagctctctgccgtgaccgagttc
acccacgaatctgctcaagaaatcgtcggaggagacctcaaaaagttccactttttgatc
atccgcaagtcagactcttctttcgatgagactattgccaagttcactgaggtcgctaag
aagttccgtgctaagatcgtctttgttcttctcgacgttgatgttgaagagaacgcaaga
attctcgagttcctcggagtcgatgccaagaacaccccagccaacagaattgtcagcctt
gccgatcaagttgagaagttcaagccacaagaaggagaagatttcgaagctttcaccaac
tcatatttggaaggaaagtctgctcaagacttgaaggctcaagatcttccagaagattgg
aatgcactcccagttaaggttctcgtcgcctccaacttcaacgaaattgcccttgatgaa
accaagactgtcttcgtcaaattctacgccccatggtgcggacattgcaagcaactggtt
ccagtttgggatgagcttgctgagaagtacgagtccaacccaaatgttgtcattgcaaag
cttgatgctactctcaacgagcttgccgacgtcaaggtcaactctttcccaaccctgaag
ctgtggccagccggatcttctaccccagtcgactatgatggagacagaaacctcgagaag
ttcgaagaatttgtcaacaagtatgctggatctgcttccgaatctgaaaccgcatctcag
gatcacgaagagctttaa

DBGET integrated database retrieval system