KEGG   Caenorhabditis elegans (nematode): CELE_C14B9.2Help
Entry
CELE_C14B9.2      CDS       T00019                                 

Gene name
C14B9.2
Definition
Protein C14B9.2
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_C14B9.2 (C14B9.2)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CELE_C14B9.2 (C14B9.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(8133675..8133865,8134233..8135796,8136303..8136404)
Genome map
AA seq 618 aa AA seqDB search
MMFDRRFFALVVLLCVSAVRSTEDASDDELNYEMDEGVVVLTDKNFDAFLKKNPSVLVKF
YAPWCGHCKHLAPEYEKASSKVSIPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPND
YDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCK
KLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPR
EAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLR
EEFKTMGHTSDPAAFKKWDAKPNDIIIFYPSLFHSKFEPKSRTYNKAAATSEDLLAFFRE
HSAPLVGKMTKKNAATRYTKKPLVVVYYNADFSVQYREGSEYWRSKVLNIAQKYQKDKYK
FAVADEEEFAKELEELGLGDSGLEHNVVVFGYDGKKYPMNPDEFDGELDENLEAFMKQIS
SGKAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYV
ELAQALKKTQPNVVLAKMDATINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDL
KKFMTKHGVKSFQKKDEL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcgaccggcgcttcttcgcactggtcgtccttctctgtgtatcggcagttcgt
tccacggaagatgcttcagatgatgagctgaactacgaaatggacgaaggagtcgttgtg
ctcactgacaagaactttgatgccttcctcaagaaaaatccaagtgttttagtgaagttc
tacgctccatggtgtggccactgcaagcacttggctccggaatacgagaaagcatcttca
aaagtgtcaattccactggccaaagtcgatgcaaccgtcgaaacagaactcggaaagaga
ttcgaaattcaaggatatccaactctcaaattctggaaagatggaaaaggtccaaacgat
tatgatggaggtagagatgaagctggaattgttgaatgggttgagtcgagagttgatcca
aattataagccaccaccagaggaggtggttactttgacaactgaaaatttcgatgatttc
atttccaacaacgagttggttcttgttgaattctatgctccatggtgtggacattgcaag
aagttggctccagaatatgagaaggctgcccaaaagttgaaggctcaaggatcaaaggtt
aagctaggaaaggttgatgctacaattgagaaggatcttggaaccaagtatggagtcagt
ggatacccaacaatgaagatcatcagaaatggaagaagatttgattataacggaccacga
gaggctgctggaatcatcaagtacatgactgatcaatcgaagccagctgctaagaaattg
ccaaaactgaaggatgtcgaacgattcatgagcaaagatgacgtcactattattggattc
tttgccaccgaagactcaactgcattcgaagcattctctgattccgctgaaatgctccgt
gaagagttcaaaacaatgggacatacatcagatccagctgcattcaagaagtgggatgcc
aagccaaatgacattattatcttctatccatctctgttccacagcaaatttgagccaaag
agcagaacatacaacaaggctgctgccacatcagaggatcttttggctttcttccgtgaa
cattctgcaccacttgttggaaaaatgaccaagaagaacgcagcaacaagatacacgaaa
aaaccattggttgttgtatattataatgctgatttctccgttcaatatagagaaggaagt
gaatactggagatccaaagttttgaatattgctcagaaatatcaaaaggacaagtacaag
ttcgctgttgctgatgaagaggagtttgccaaagaacttgaagagcttggacttggagat
tctggacttgagcataatgtagttgtatttggttatgatggaaagaaatatccaatgaat
ccagatgagtttgatggagaacttgatgagaatcttgaagcattcatgaaacaaatcagt
agtggaaaggccaaggctcacgtgaagagtgctccagctccaaaagatgataagggacca
gttaaaaccgttgttggatccaactttgataagattgtcaatgatgaatcaaaggatgta
cttattgagttttatgctccatggtgtggacattgcaagagctttgaatcaaaatacgtt
gaattggctcaagctttgaagaagacccagccaaatgttgttctcgccaagatggacgcc
acgattaacgatgctccaagccagttcgcagttgaaggcttcccaactatctactttgct
ccagctggaaagaagagtgaaccaatcaaatattctggaaatcgtgatttggaagatctc
aagaagttcatgaccaagcacggtgtgaagtcgttccagaagaaggacgagttgtaa

DBGET integrated database retrieval system