KEGG   Caenorhabditis elegans (nematode): CELE_C14C11.3Help
Entry
CELE_C14C11.3     CDS       T00019                                 

Gene name
hex-2
Definition
Protein HEX-2
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_C14C11.3 (hex-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CELE_C14C11.3 (hex-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(5654478..5654528,5654926..5655111,5655166..5655249,5655929..5656381,5656430..5656560,5657059..5657180,5657224..5657366,5657633..5657885,5657933..5658140,5658414..5658573)
Genome map
AA seq 596 aa AA seqDB search
MFPMRCIRRRSIDFVLKGVILTTICLFLFHMTSSYPKGGISQRALDSMQKEPQTPVLVQK
RENFEESIDVAVEQESKKENPFVNQQASTENAKPITQEVKIERPSRDNEFYKNVVIHFDL
KGAPPKVDYFLDLLRLIAKGGATGILLEWEDMFPWTGKLEQFKNTDAYSESDVDMILSEA
TKLKLDVIPLVQTFGHLEWILKYEEMRKYRENDAYPQVLCLGNEEGVEFVREMIRQVAKK
HAKYGIPFFHIGADEAFEFGVCQESLDWIKKNGKNGRKQLLALAHLKAIAEFAKQQTGDS
TQILAWHDMLKDFDSRLIKNLELGQIIQPVVWDYSENIITLNDYIFSALAENFPTMWASS
AYKGANYPSASTSEVRHYETNNRNWIRTKQNQERKFKNGFQGIIVTGWQRYDHLAGLCET
LPIGTASMMLQMQIALNAPALDLEGTRQKAATLLECQGFNVDGVKVVSNQCKYRGFQTYL
IYQSEVPNLFARIDSELSKNHHLMGWANRYNRKYNISQNWYHREMLPFVQQLVGQYDRVE
SDLRASMKDLYFENTIDEFIYENLGEMSEKLHGYLEEIQRLDKLRAWPKRHFPIKK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgatgcggtgtattcgacgacggtccatcgattttgttttgaagggtgtaatt
ctcacgacaatatgcctcttcctatttcatatgacctcatcatatccgaagggagggatt
agtcagagagcacttgactcaatgcagaaggaaccacagacacctgtgcttgtacagaaa
cgagagaatttcgaggagagcatcgatgtagctgttgagcaagaatccaagaaagagaat
ccatttgtcaatcagcaggcatcgacagaaaatgcaaaaccaattacacaagaagtgaag
attgaacggccttccagagataatgaattctacaagaatgtggttatccattttgatctc
aaaggtgctccaccaaaagtcgactatttcctggatcttctaagacttattgccaaagga
ggagctactggaatacttctcgaatgggaagatatgtttccatggacgggaaaattggag
cagtttaagaacacagatgcatattcagagagtgatgtggatatgattctgagcgaggca
acgaaattgaagctcgacgtgattccattggttcaaacattcggccatttggagtggatt
ttgaaatacgaggaaatgaggaaatatagagagaatgacgcttatccacaagttttatgt
ctgggaaatgaggaaggtgtggaatttgtaagagaaatgattagacaagtggcaaagaag
catgcaaagtatggaatcccattctttcatattggtgctgatgaagcttttgagtttgga
gtttgccaagaatcactggattggatcaagaaaaatgggaagaacggaaggaagcaactt
ttggcgctggctcatttgaaggctatcgcagaatttgcgaaacagcaaaccggagattct
acacaaatccttgcgtggcatgatatgctcaaagacttcgactctcggctcataaaaaat
ctcgaattaggacaaataattcaaccggttgtttgggattattcggagaatattatcaca
ctaaacgattacatattctcggcacttgcggaaaatttccccacgatgtgggcttcttcg
gcgtacaagggagccaactatccatctgcttctacttcagaagttagacattatgagact
aataatagaaattggatcagaactaaacagaaccaagaaagaaagttcaaaaatggattc
caaggaatcattgtcactggatggcagcgatatgatcatttagctggactttgtgagact
cttcccatcggaactgcttcaatgatgcttcaaatgcaaattgctctaaatgcaccagct
ctagatttagaaggaactagacaaaaagctgcaacactattagaatgtcaaggattcaat
gtggatggagtgaaggttgtcagcaatcagtgtaaatatagaggattccaaacatatttg
atctaccagagcgaggttccgaatctgtttgctagaatcgacagtgaactgagtaaaaac
catcatttaatgggatgggctaatcgatacaataggaaatacaacatttctcaaaattgg
taccatcgtgaaatgcttccatttgtacagcaacttgttggccaatacgatcgggttgaa
agtgatctcagagcttcgatgaaagatttgtactttgagaatacaatagatgaattcatt
tacgagaatctcggggaaatgtcggagaaacttcacggttatttggaagaaattcagcga
cttgacaaacttcgagcatggccaaaaaggcatttcccaatcaagaaatga

DBGET integrated database retrieval system