KEGG   Caenorhabditis elegans (nematode): CELE_C14F11.6Help
Entry
CELE_C14F11.6     CDS       T00019                                 

Gene name
C14F11.6
Definition
Protein C14F11.6
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Polyketide sugar unit biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CELE_C14F11.6 (C14F11.6)
Enzymes [BR:cel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CELE_C14F11.6 (C14F11.6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:complement(join(6238195..6238304,6238350..6238557,6238651..6238728,6238782..6238871,6238936..6239022))
Genome map
AA seq 190 aa AA seqDB search
MSHPTPGKRFQLEKEVIEAIPDLLVIKPKVFPDERGFFSESYNKTEWAEKIGYTEDLQQD
NHSFSHYGVLRGLHTQPHMGKLVTVVSGEIFDVAVDIRKDSPTYGKWHGVVLNGDNKHAF
WIPAGFLHGFQVLSKEGAHVTYKCSAVYDPKTEFGINPFDEDINVDWPIRDKTVVIVSER
DTQHASFKSL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcctactccaggaaaacgtttccaactcgagaaagaagtcatcgaggctatc
ccggaccttcttgtcattaagccaaaggtgttcccagacgagcgtggtttcttttccgag
agttacaacaaaactgaatgggcagagaaaatcggctacactgaggatcttcaacaggat
aaccactcgttctcccattatggcgttctccgtggtcttcatacccaaccacacatggga
aaattagttactgtggttagcggcgagatcttcgatgtggctgttgacattcgcaaggac
agtccaacgtacggaaaatggcatggagtggttctcaacggagataataagcacgcattc
tggattccagccgggttccttcacggattccaagttctcagcaaagaaggagctcatgtc
acttataagtgctccgctgtttacgatccaaaaaccgaattcggaatcaacccattcgac
gaggatatcaatgtagattggccaatcagggataaaacggttgttattgtttcggagcga
gacacacaacatgcatcattcaaatctctataa

DBGET integrated database retrieval system