KEGG   Caenorhabditis elegans (nematode): CELE_C18C4.3Help
Entry
CELE_C18C4.3      CDS       T00019                                 

Gene name
ugt-48
Definition
Protein UGT-48
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CELE_C18C4.3 (ugt-48)
   00053 Ascorbate and aldarate metabolism
    CELE_C18C4.3 (ugt-48)
   00500 Starch and sucrose metabolism
    CELE_C18C4.3 (ugt-48)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_C18C4.3 (ugt-48)
   00860 Porphyrin and chlorophyll metabolism
    CELE_C18C4.3 (ugt-48)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_C18C4.3 (ugt-48)
   00982 Drug metabolism - cytochrome P450
    CELE_C18C4.3 (ugt-48)
   00983 Drug metabolism - other enzymes
    CELE_C18C4.3 (ugt-48)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CELE_C18C4.3 (ugt-48)
Glycosyltransferases [BR:cel01003]
 Others
  Hydrophobic molecule
   CELE_C18C4.3 (ugt-48)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(5545705..5545972,5546292..5546590,5546641..5546805,5546851..5547004,5547051..5547248,5547296..5547431,5547478..5547576,5547793..5548054))
Genome map
AA seq 526 aa AA seqDB search
MLLRILTFLAVCQVTTSHKILMFSPTASKSHMISQGRIADELANAGHEVVNFEPDFLNLT
DKFVPCKKCRRWPVTGLNNYKFKKIQNGLSGDVFQQSSIWSKIFNTDSDPYQDEYTNMCE
EMVTNKELIEKLKKEKFDAYFGEQIHLCGMGLAHLIGIKHRFWIASCTMSVSMRDSLGIP
TPSSLIPFMSTLDATPAPFWQRAKNFVLQMAHIRDEYRDVVLTNDMFKKNFGSDFPCVEF
LAKTSDLIFVSTDELLEIQAPTLSNVVHIGGLGLSSEGGGLDEKFVKIMEKGKGVILFSL
GTIANTTNLPPTIMENLMKITQKFKDYEFIIKVDKFDRRSFDLAEGLSNVLVVDWVPQTA
VLAHPRLKAFITHAGYNSLMESAYAGVPVILIPFMFDQPRNGRSVERKGWGILRDRFQLI
KDPDAIEGAIKEILVNPTYQEKANRLKKLMRSKPQSASERLVKMTNWVLENDGVEELQYE
GKHMDFFTFYNLDIIITAASIPVLIFIVLRISNISIITSSPKNKKD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacggatactcacatttcttgctgtttgccaagtgactacctctcacaaaatc
ctgatgttctcgccaactgcaagcaagtcacatatgatctcacagggaagaatcgcagat
gagttggcgaatgctggacacgaggttgtgaatttcgagccagattttttgaatttaaca
gacaaatttgtgccatgcaaaaagtgtagaagatggccagttactggattgaataactat
aagttcaagaaaattcaaaatgggttatctggagacgtattccaacaatcttcaatttgg
agcaaaattttcaatacggatagtgatccatatcaggatgaatacacaaatatgtgcgaa
gaaatggtaacgaacaaagaacttatcgaaaaactgaaaaaagaaaagttcgatgcatat
ttcggtgagcagattcatttgtgtggaatggggttggctcatcttataggcatcaagcac
aggttttggattgccagttgcacaatgagcgttagtatgcgtgatagtctcggaattcca
acgccgtccagcttgatacccttcatgtcaacattggacgctaccccggctccattctgg
caaagagccaagaactttgtgctccaaatggcacatattagagacgaatatagggatgtt
gtactgacaaacgatatgtttaaaaagaactttggatctgacttcccatgtgtcgaattc
ttggcaaaaacttctgatcttatatttgtttcaacagatgaacttttggaaattcaagct
cccactctttcgaatgttgtacacatcggagggcttggcttgtcaagtgaaggaggtggc
ttggacgagaaatttgtgaaaattatggaaaaaggaaaaggagtgattttattctcattg
gggacaattgccaacactactaatctaccaccaactatcatggaaaacttaatgaagatc
actcaaaaattcaaagattatgagttcataattaaagttgacaagtttgatagaagaagt
tttgatcttgctgagggactctcaaatgtcctcgtcgtggattgggttccccaaaccgca
gttcttgctcatccaagactgaaagcattcatcacacatgctggttacaacagtttgatg
gaatctgcctatgcaggtgttccagttattcttattccatttatgtttgatcaaccaaga
aatggacggtctgtcgagagaaaaggatggggaattctgagagataggttccagttgatt
aaagatccagatgcgattgagggagctatcaaggagattctcgttaatccaacataccaa
gaaaaagcaaaccgtctgaaaaagttgatgcgtagcaagcctcaatcggcatctgaaaga
ctggttaaaatgacaaattgggtgctggaaaacgacggtgtagaagaattgcaatacgag
ggaaaacatatggactttttcacattttacaatcttgatatcattattactgcagcttcg
atcccagttttaatttttattgttcttcgaatttcaaacattagtattattacgagtagc
ccaaaaaataagaaagattag

DBGET integrated database retrieval system