KEGG   Caenorhabditis elegans (nematode): CELE_C23G10.4Help
Entry
CELE_C23G10.4     CDS       T00019                                 

Gene name
rpn-2
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 1
  KO
K03032  
26S proteasome regulatory subunit N2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Proteasome
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    CELE_C23G10.4 (rpn-2)
Proteasome [BR:cel03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     CELE_C23G10.4 (rpn-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
EnsemblGenomes-Tr: 
UniProt: 
Position
III:join(6199186..6199240,6199291..6199818,6199865..6199995,6200046..6201266,6201319..6201468,6201516..6202042,6202141..6202426)
Genome map
AA seq 965 aa AA seqDB search
MLTLLNRWRSQPGGASNAAAFIRVLESPKSAVTDKVLVLKAFNDWDVLVNTWFEVADALP
AVEQLLDNNTFPEHSSAALLVSKVYFCLEQYERALEFALRGDFNVVPATRTGLGNDAEYV
NKIIETAIDTYKTLSKQGSGIPQKLRDLIDRIVARNLDKREIWFVISLGFETTNLAMIDR
AISAMPADLTIKNQTTLVETLNRVVNGAFDRSFRFQVIDTVIKTYLKCPSPDMSKICECY
VLTDNAEAAADTITSLIAKSLSTRAYQIAFDLYETASQGFLDRVLKRFQQQDARDEKSME
KIHSILKGHETVKAYLDFFVRHNHTDSVLMEEIKENIRTASAHNALLISNGLMQYGTTCD
DFLRNNLNWVSKATNWNKFNAVASLGLIHHGQESSAMKVLEPYLPKESVEGFGFKEGGAM
LAYGLIHAKHGDATAMSTLAQWLKTAENEPVRHGACLGFGVAGLGSSSVSNYEKVREVLQ
RDEAVSGESAGIAMGLIMAGHLNQEVFNELKQYTVDTQHDKTQRGIRTGLACAAFGLQGD
AEPYIKEAIGAKSNPMLRSTGICMLSMAYAGTGSPDVVRRLLEKVATDPNLDVKRYATIG
IGFVLSKDPSTCLSYVAMLTEHFNGHVRYGAAMALGIACAGTGNMEAIALIEPMISDKEG
FVRKGALLSLALIMCQQTDYTCPKVNGFRKQLLKKIGEKNEDSLVKFGAIIAQGLLDIGG
QNAAVTMQNSDKQPDMGSMVGMMCFLHGWFWHSMHFFIALAAKPSCLVMMNENLKIPVLD
YICHANSQKFAYPPRAESKKDKDVKKIETVVLSITGKKNASKKLIAEEKKRREAAASASS
AAAAPSSSSTSGTAPAAEDEKMEVDQPGKSKKEKAPEKDTKPLHRLQNPARVIPAQRQLI
SISDARAYSPMKPLYKGGIIVADRVDKEREEKLVSEVVTQVNTPASSGNTENKPHSTFEI
NINDF
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgttgacattgttgaacagatggagatctcagccaggaggcgcttcaaacgcagccgca
ttcattcgtgttctcgagtcaccgaaatcagcagtgaccgacaaagtgctcgttctcaaa
gcatttaacgattgggatgttcttgtgaacacatggtttgaggtcgctgacgcccttcca
gctgtagagcagctccttgacaacaacacgttcccagagcattcatccgctgcactgctc
gtctccaaagtttatttctgcttggagcagtatgaacgtgctttggagtttgctcttcgt
ggtgatttcaacgtcgttcctgctacaagaaccggtcttggaaacgacgcagaatatgtt
aacaagatcatcgagacggccattgacacgtacaagacgctgagcaagcaaggatctgga
attcctcagaaactccgagatttgatcgaccgaattgttgctagaaatctggataaacga
gagatatggtttgtcatctcgttaggatttgagacgaccaatctggctatgatcgacagg
gccattagcgcgatgcctgcagatttgaccatcaagaatcagactacacttgtcgaaacg
ctcaaccgtgttgtcaatggcgcgttcgatcgttcattccgattccaagttatcgataca
gtcatcaagacgtacttgaagtgcccatcgccggacatgtccaagatttgcgagtgttac
gtgctcacggataacgccgaggccgctgctgacacgattacgagtttgatcgcgaagtct
ctcagcactcgtgcatatcagatcgcatttgatttatatgaaacagcgagtcaaggattc
ctcgatcgagttttgaaacgtttccaacagcaggatgctcgtgatgagaagtcgatggaa
aagattcattcaattctcaaaggtcatgaaactgtcaaggcttacctcgacttctttgtc
cgtcataatcacactgattctgttctaatggaagagatcaaggagaacattcgaacagcc
tctgcccacaatgctcttctcatctcaaatggtcttatgcaatatggaactacttgtgac
gatttcctccgtaacaacttgaactgggtttccaaagctacgaactggaacaagttcaat
gcggtcgcttcacttggactcattcatcacggacaagaatcgtctgcaatgaaggtactt
gagccatatttgccaaaggaatctgtcgaaggatttggatttaaagagggaggagcaatg
ctggcatatggattgattcacgccaaacacggagatgcaactgccatgagcactctggct
cagtggctcaaaaccgccgaaaacgagccagtgagacacggagcttgtcttggatttgga
gttgctggacttggatcgtcttctgtttcgaattacgagaaagttcgggaagttctccaa
cgtgatgaagcagtttccggagaatccgcaggaatcgccatgggccttatcatggctgga
catctgaatcaagaggtgttcaatgagctcaagcaatacactgttgacacacagcatgac
aaaactcaacgtggtatccgaactggacttgcctgtgccgcattcggactccaaggagat
gctgagccttacatcaaagaagcaatcggagctaagagcaatccaatgctccgttccact
ggaatctgtatgctgtcgatggcttacgccggaaccggatctccagatgtagtacgccgt
cttctcgagaaagtagccaccgatccaaatttggatgtcaagagatacgctacaattggt
atcggattcgttctctccaaggatccatcaacctgcttatcctacgtggccatgctcacc
gaacatttcaatggacatgtcagatacggagcagctatggcactgggaattgcttgtgct
ggaacaggaaacatggaagctattgctctgattgagccaatgatttctgataaggaaggt
ttcgttcgtaaaggagcacttctttcacttgctctcatcatgtgccagcagacagactac
acttgtcccaaggtgaacggtttccgtaagcaattgctcaaaaagatcggagagaagaac
gaggactctcttgtcaaatttggagcaattattgctcaaggacttctcgacatcggaggg
cagaacgctgcggtcacaatgcaaaattctgacaagcagccagatatgggatcaatggtc
ggaatgatgtgcttccttcacggatggttctggcactcgatgcatttcttcatcgccctt
gctgctaagccatcatgccttgtgatgatgaacgagaatctgaagattccagtacttgac
tacatctgccatgccaatagtcagaagtttgcctatccaccacgagccgaatcaaagaag
gataaggatgtcaaaaagattgagactgttgttctgtccatcaccggaaagaagaatgcg
tcaaagaagctgatcgctgaggagaaaaaaagacgagaagctgcagcttccgcttctagt
gctgctgctgccccatcatcatcgtccacttcaggaacagcaccagctgctgaagatgag
aaaatggaggttgatcaaccaggaaaatccaagaaagaaaaggctccagaaaaggacacg
aagccattgcaccgcctacagaatccagctcgtgtgattcctgctcaacgacagctaatc
tcgatcagtgacgctcgagcctacagtcccatgaagccactttacaagggtggaattatt
gtggcggatcgtgttgataaggagagagaggagaagcttgtcagtgaagtcgtcactcag
gtcaatactcctgcgagctctggaaataccgaaaacaaaccccattcgacgttcgagatc
aatatcaacgatttttga

DBGET integrated database retrieval system