KEGG   Caenorhabditis elegans (nematode): CELE_C24H11.5Help
Entry
CELE_C24H11.5     CDS       T00019                                 

Gene name
C24H11.5
Definition
Protein C24H11.5, isoform B
Orthology
K13135  
gem associated protein 7
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_C24H11.5 (C24H11.5)
Spliceosome [BR:cel03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    CELE_C24H11.5 (C24H11.5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(11780135..11780218,11780408..11780507,11780781..11780875)
Genome map
AA seq 92 aa AA seqDB search
MAQSTQEAEGEQQRRQAVLRERYLSFLQKSADKPATIEMCERTTVTATIKAFQPSSEHVI
VEKLATPIGILDKAALRSTDIVKITFDGNSKN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagcacacaagaagcagaaggagagcaacagaggcgacaagctgtgctccgg
gagcgatatttgagctttttgcagaaatccgccgacaagccagccaccatcgaaatgtgc
gaacgaactacggtcaccgccacaattaaagcatttcaaccgtcttcggagcacgtgatc
gtcgaaaaactcgccacacccatcggaattctcgacaaagccgcactacgatcgacggat
attgtcaaaatcacatttgacggaaattcgaaaaattaa

DBGET integrated database retrieval system