KEGG   Caenorhabditis elegans (nematode): CELE_C26C6.3Help
Entry
CELE_C26C6.3      CDS       T00019                                 

Gene name
nas-36
Definition
Protein NAS-36
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C26C6.3 (nas-36)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C26C6.3 (nas-36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(7527307..7527408,7527896..7528006,7528051..7528135,7528177..7528255,7528310..7528380,7528428..7528551,7528869..7528935,7528987..7529070,7529123..7529366,7529693..7529818,7529930..7530164,7530221..7530336,7530573..7530623,7530672..7530798,7530894..7531004,7531268..7531388)
Genome map
AA seq 617 aa AA seqDB search
MRLCHSIILFNSLISISICSKADDPALLVASEFKEHFNVEEKQLETVEELLIKMKKLAHS
RSFKGREFGHDAVEDSKKEVAISTQQGTINKKVSPFLFEGDIFLSRRQAVDILKALSKDK
TKRLRRSFVSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSPD
GDYIEFFSGQGCYSMIGRNGGRQGISIGESCVKMGVIEHEIGHALGLWHEQSRPDALGYV
TIERDFILPSYISDFLQRDDEIDTLGIPYDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQ
TIGQREKLSFYDVATINTAYCKDECKSEKTKCENGGYMRPSKCSECLCPDGLGGEKCEKN
EDSKNAECGGIIKLTEEWKEIESPNYPDPGYEADQKCSWLLKAEKGKRVEIEFIEDFSFL
CTSTCVDFVELKISDDLRNTGFRFCCYDKPEISFVSQTDTAIIIFRSQLSTDIGFKIQAK
STDAEPRTTIAPTIITTTLAPITVDAPNVWADWGEWSMCSRTCGGCGIRSRVRSCRSKKC
EGRRQEFGTCNLKACPVDKHCAKLLSNNRLCNGKVCTKNDIAISSCDAPQCCPPFINVDG
VCQSDQENQHDELWLSI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagattatgtcattcaattattttatttaattctttaatttctatttctatttgctcg
aaagctgatgatcctgcacttttggttgctagtgaatttaaggagcatttcaatgtggaa
gaaaaacaattggaaactgttgaagaattgcttattaaaatgaaaaaattggcgcattca
agaagttttaagggaagagaatttggtcatgatgcagttgaagactcaaagaaagaagtg
gcaattagtactcaacaaggaacaattaataaaaaagtttcaccgtttttgtttgaaggt
gatatttttctatctcgacgtcaagcagttgatattctgaaagctttatcaaaagataaa
accaaacgattgagaagatcatttgtttcggataaaactgccacgtggaaaaccatgcca
atcaagtatcgttttcatgaaagtatagatttctatacaattagtcaaatcatcgcagcg
attcgtttctgggaagattccacgtgtatcacttttgaaaatgtttctgattcaccagat
ggtgattatatcgagtttttcagtggacaaggatgctactctatgatcggacgaaacggt
ggtcgtcaaggtatttcaattggtgaaagttgtgttaaaatgggcgtcattgaacatgaa
attggacacgcactcgggctttggcatgaacagagtagacctgatgcattgggttatgtt
actatcgaacgagattttattcttccttcgtatataagtgatttccttcaacgtgacgat
gaaattgatacattgggaataccgtatgatttgggatcagtaatgcattatggaagtact
gcatttagtgttgatcagaaaagtaaaacagttgttacaagagattcactttatcaacag
actattggacaacgagaaaaactttcgttttatgacgtggcaactataaatactgcctat
tgtaaagatgaatgcaagtctgaaaaaaccaaatgtgaaaatggaggatatatgagacca
tcaaaatgctccgaatgtctttgtccagatggtcttggtggagaaaagtgtgagaagaat
gaagactcgaaaaacgctgaatgtggtggaattattaaattaactgaagaatggaaagag
attgaatctccaaattatccggatccaggatatgaagctgatcaaaaatgttcttggttg
ttgaaagcggaaaaaggaaaacgagtggaaattgaatttattgaagatttctcatttctc
tgtacatctacatgcgttgattttgtagagctgaagatttctgatgacttgagaaatact
ggattcagattctgctgctatgataaaccagaaatcagttttgtttctcagactgacact
gctattattattttccgatcacaactttctacggatattggatttaaaattcaagcaaaa
tctaccgatgccgaaccaaggacaacaattgctccaacaattatcacaacaactttggca
ccaataactgttgatgcaccaaatgtatgggcagattggggtgaatggtcaatgtgttca
agaacatgtggaggttgtggaattagaagtcgggtcagatcatgtagaagcaaaaagtgc
gagggacgacgacaagaatttggaacctgtaatttgaaagcgtgccctgttgataaacat
tgcgcaaagctactatcaaataataggctttgcaatggaaaagtgtgtaccaaaaacgac
attgcaatatcgtcatgtgatgctccacaatgttgtcctccgtttattaatgttgatgga
gtatgccaatctgatcaagaaaatcaacatgatgaattatggctttctatttaa

DBGET integrated database retrieval system