KEGG   Caenorhabditis elegans (nematode): CELE_C26C6.3Help
Entry
CELE_C26C6.3      CDS       T00019                                 

Gene name
nas-36
Definition
Protein NAS-36
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C26C6.3 (nas-36)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C26C6.3 (nas-36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(7527303..7527404,7527892..7528002,7528047..7528131,7528173..7528251,7528306..7528376,7528424..7528547,7528865..7528931,7528983..7529066,7529119..7529362,7529689..7529814,7529926..7530160,7530217..7530332,7530569..7530619,7530668..7530794,7530890..7531000,7531264..7531384)
Genome map
AA seq 617 aa AA seqDB search
MRLCHSIILFNSLISISICSKADDPALLVASEFKEHFNVEEKQLETVEELLIKMKKLAHS
RSFKGREFGHDAVEDSKKEVAISTQQGTINKKVSPFLFEGDIFLSRRQAVDILKALSKDK
TKRLRRSFVSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSPD
GDYIEFFSGQGCYSMIGRNGGRQGISIGESCVKMGVIEHEIGHALGLWHEQSRPDALGYV
TIERDFILPSYISDFLQRDDEIDTLGIPYDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQ
TIGQREKLSFYDVATINTAYCKDECKSEKTKCENGGYMRPSKCSECLCPDGLGGEKCEKN
EDSKNAECGGIIKLTEEWKEIESPNYPDPGYEADQKCSWLLKAEKGKRVEIEFIEDFSFL
CTSTCVDFVELKISDDLRNTGFRFCCYDKPEISFVSQTDTAIIIFRSQLSTDIGFKIQAK
STDAEPRTTIAPTIITTTLAPITVDAPNVWADWGEWSMCSRTCGGCGIRSRVRSCRSKKC
EGRRQEFGTCNLKACPVDKHCAKLLSNNRLCNGKVCTKNDIAISSCDAPQCCPPFINVDG
VCQSDQENQHDELWLSI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagattatgtcattcaattattttatttaattctttaatttctatttctatttgctcg
aaagctgatgatcctgcacttttggttgctagtgaatttaaggagcatttcaatgtggaa
gaaaaacaattggaaactgttgaagaattgcttattaaaatgaaaaaattggcgcattca
agaagttttaagggaagagaatttggtcatgatgcagttgaagactcaaagaaagaagtg
gcaattagtactcaacaaggaacaattaataaaaaagtttcaccgtttttgtttgaaggt
gatatttttctatctcgacgtcaagcagttgatattctgaaagctttatcaaaagataaa
accaaacgattgagaagatcatttgtttcggataaaactgccacgtggaaaaccatgcca
atcaagtatcgttttcatgaaagtatagatttctatacaattagtcaaatcatcgcagcg
attcgtttctgggaagattccacgtgtatcacttttgaaaatgtttctgattcaccagat
ggtgattatatcgagtttttcagtggacaaggatgctactctatgatcggacgaaacggt
ggtcgtcaaggtatttcaattggtgaaagttgtgttaaaatgggcgtcattgaacatgaa
attggacacgcactcgggctttggcatgaacagagtagacctgatgcattgggttatgtt
actatcgaacgagattttattcttccttcgtatataagtgatttccttcaacgtgacgat
gaaattgatacattgggaataccgtatgatttgggatcagtaatgcattatggaagtact
gcatttagtgttgatcagaaaagtaaaacagttgttacaagagattcactttatcaacag
actattggacaacgagaaaaactttcgttttatgacgtggcaactataaatactgcctat
tgtaaagatgaatgcaagtctgaaaaaaccaaatgtgaaaatggaggatatatgagacca
tcaaaatgctccgaatgtctttgtccagatggtcttggtggagaaaagtgtgagaagaat
gaagactcgaaaaacgctgaatgtggtggaattattaaattaactgaagaatggaaagag
attgaatctccaaattatccggatccaggatatgaagctgatcaaaaatgttcttggttg
ttgaaagcggaaaaaggaaaacgagtggaaattgaatttattgaagatttctcatttctc
tgtacatctacatgcgttgattttgtagagctgaagatttctgatgacttgagaaatact
ggattcagattctgctgctatgataaaccagaaatcagttttgtttctcagactgacact
gctattattattttccgatcacaactttctacggatattggatttaaaattcaagcaaaa
tctaccgatgccgaaccaaggacaacaattgctccaacaattatcacaacaactttggca
ccaataactgttgatgcaccaaatgtatgggcagattggggtgaatggtcaatgtgttca
agaacatgtggaggttgtggaattagaagtcgggtcagatcatgtagaagcaaaaagtgc
gagggacgacgacaagaatttggaacctgtaatttgaaagcgtgccctgttgataaacat
tgcgcaaagctactatcaaataataggctttgcaatggaaaagtgtgtaccaaaaacgac
attgcaatatcgtcatgtgatgctccacaatgttgtcctccgtttattaatgttgatgga
gtatgccaatctgatcaagaaaatcaacatgatgaattatggctttctatttaa

DBGET integrated database retrieval system