KEGG   Caenorhabditis elegans (nematode): CELE_C27A7.5Help
Entry
CELE_C27A7.5      CDS       T00019                                 

Gene name
C27A7.5
Definition
(RefSeq) C27A7.5, isoform A
  KO
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CELE_C27A7.5 (C27A7.5)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     CELE_C27A7.5 (C27A7.5)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     CELE_C27A7.5 (C27A7.5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EnsemblGenomes-Gn: 
EnsemblGenomes-Tr: 
UniProt: 
Position
V:complement(join(12155027..12155215,12155264..12155379,12155488..12155600,12155648..12155903,12155962..12156031,12156284..12156481,12156531..12156745,12156796..12157210,12157259..12157413,12158049..12158175,12160298..12160437,12160859..12160951,12162243..12162297))
Genome map
AA seq 713 aa AA seqDB search
MIYSSLTRGFVMRLFQGAAYKPKSAFIKKMSDGTCPPINIRRCSCTSDGLSPKKSLTSPI
WDRRPSKILDENHLPKQLLVQHHHEDGAFLRNISATELVLEVQETAGTQQIGAPSALPES
RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDRRYIEESYSNVAVRPYSLPPV
RNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASA
LSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNR
TVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFP
SMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQV
DVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIAS
KGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFS
ATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAKAMDCIIAIRD
AGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEI
VAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQALTNNDEVFHLE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgatctactcgtcactgacacgtggatttgtaatgcgattattccagggagcagcatat
aaaccaaaaagtgcctttatcaaaaagatgagtgatggaacgtgtccaccaatcaatatt
cgaagatgttcgtgcacaagtgatggactctcaccgaagaaatcactgacatctccaatt
tgggaccgtcgaccttcgaaaattctagatgaaaaccatttaccaaaacaacttctcgtc
caacatcatcacgaagatggcgcgtttcttcgaaatatttcagcgacggagctcgttctc
gaagttcaagaaaccgccggaactcagcaaattggcgctccgtcagcacttccagagtca
cgagttctcgttctctacactggtggaactattggaatgaaaacaacggatggagtttat
tgtcccgttcccggataccttcctgaggttcttcgcgatattcctccattgaatgatcgt
cgatacattgaagagagctactcaaatgttgcagtacgtccatactcacttccaccagtt
cggaacatgaaaaagagagttgtttattggattgtcgaatacgagccacttctcgattcc
tgtgatatgacatttgacgattggattcgcatagctacggatatcaagaaagcctaccac
aagtacgatggatttgttgttcttcatggaactgatactcttgcttatactgccagtgca
ctttcattcatgatggaaaatcttggaaaaccagtcattatcacgggaagtcaaattcca
gttgcagaagtacgttctgatggaatggagaatcttatcggagctttgatcaccgcggga
aattttgatattcccgaagtttgtgtttatttcaataacaaactgatgcgtggaaatcga
acagtaaaattggataattctgcccttgaagcttttgacagtccaaatatgcatccatta
gctcagatggctataaatatcaaggttaactacgattccattttccgaagtgacatggtt
gccgctttcactgttcatgagaatctttgccgtgacgtaggaatgcttcgaatttttcca
tcaatgactattgaatcagttcgtgcttttttacaaccaccaacgagggggtgtatttta
caaactttcggatctggaaacatgccaactagacgacaggacattattatggccttgaag
gaagctatagctcgcggtgtgatggttgtgaattgctcacagtgtctgaaaggacaagtt
gatgtcaattatgcaacgggtaaaattttgtacgacatcggagtgatccctggatcggac
atgacctcggaagccgcaatggccaaattatgctacgtgttagggaaagatgaatgggac
ttgccaatgaaaagaagtatgctgcaatcaaatcttcgtggtgaaatgacaattgcttca
aagggagccatgcgtgagcttgatataattcctcatatcgcaaaatgccttcgtgtctct
tcatctcaagaagttcaattgctccgtgacatcattcttccaccaatgttttgtaatgct
gctaagacgaatgacgtagaaattctgaaatcgctgaaagcagccggagtcaatttctcg
gcaactgattacaatcttcgaactgctcttcatgttgctgcctccaatggacatctcgaa
tctgtcaattatttacttaagataggaacgaatgttcacatcaaagatatgtttggatat
aatgcacttgtgtgtgcagtgaaagcaaaagccatggactgtatcattgcgatcagagac
gctggtggattcattgatgcttcagctcaaaaaattggtgtggaactttgtcttgctgtg
taccaaaatgacatggaacttttgaagtgtaatgaggcagccggaactcacatgggcgag
aaggattatgacaatcggacggcgttgcatgtggccgcgtcactgaataagccagagatt
gtcgcctatcttctgcaatgtggtttgaatccacacgaaaaggatgattttggaattaca
cctatggatgaagcgaaacggcgaaacttgcaaaatttaatggatatgatggcggaacac
caagctcttacaaataatgacgaagtattccacttggaatga

DBGET integrated database retrieval system