KEGG   Caenorhabditis elegans (nematode): CELE_C27A7.5Help
Entry
CELE_C27A7.5      CDS       T00019                                 

Definition
Protein C27A7.5, isoform A
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(12155008..12155196,12155245..12155360,12155469..12155581,12155629..12155884,12155943..12156012,12156265..12156462,12156512..12156726,12156777..12157191,12157240..12157394,12158030..12158156,12160279..12160418,12160840..12160932,12162224..12162278))
Genome map
AA seq 713 aa AA seqDB search
MIYSSLTRGFVMRLFQGAAYKPKSAFIKKMSDGTCPPINIRRCSCTSDGLSPKKSLTSPI
WDRRPSKILDENHLPKQLLVQHHHEDGAFLRNISATELVLEVQETAGTQQIGAPSALPES
RVLVLYTGGTIGMKTTDGVYCPVPGYLPEVLRDIPPLNDRRYIEESYSNVAVRPYSLPPV
RNMKKRVVYWIVEYEPLLDSCDMTFDDWIRIATDIKKAYHKYDGFVVLHGTDTLAYTASA
LSFMMENLGKPVIITGSQIPVAEVRSDGMENLIGALITAGNFDIPEVCVYFNNKLMRGNR
TVKLDNSALEAFDSPNMHPLAQMAINIKVNYDSIFRSDMVAAFTVHENLCRDVGMLRIFP
SMTIESVRAFLQPPTRGCILQTFGSGNMPTRRQDIIMALKEAIARGVMVVNCSQCLKGQV
DVNYATGKILYDIGVIPGSDMTSEAAMAKLCYVLGKDEWDLPMKRSMLQSNLRGEMTIAS
KGAMRELDIIPHIAKCLRVSSSQEVQLLRDIILPPMFCNAAKTNDVEILKSLKAAGVNFS
ATDYNLRTALHVAASNGHLESVNYLLKIGTNVHIKDMFGYNALVCAVKAKAMDCIIAIRD
AGGFIDASAQKIGVELCLAVYQNDMELLKCNEAAGTHMGEKDYDNRTALHVAASLNKPEI
VAYLLQCGLNPHEKDDFGITPMDEAKRRNLQNLMDMMAEHQALTNNDEVFHLE
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgatctactcgtcactgacacgtggatttgtaatgcgattattccagggagcagcatat
aaaccaaaaagtgcctttatcaaaaagatgagtgatggaacgtgtccaccaatcaatatt
cgaagatgttcgtgcacaagtgatggactctcaccgaagaaatcactgacatctccaatt
tgggaccgtcgaccttcgaaaattctagatgaaaaccatttaccaaaacaacttctcgtc
caacatcatcacgaagatggcgcgtttcttcgaaatatttcagcgacggagctcgttctc
gaagttcaagaaaccgccggaactcagcaaattggcgctccgtcagcacttccagagtca
cgagttctcgttctctacactggtggaactattggaatgaaaacaacggatggagtttat
tgtcccgttcccggataccttcctgaggttcttcgcgatattcctccattgaatgatcgt
cgatacattgaagagagctactcaaatgttgcagtacgtccatactcacttccaccagtt
cggaacatgaaaaagagagttgtttattggattgtcgaatacgagccacttctcgattcc
tgtgatatgacatttgacgattggattcgcatagctacggatatcaagaaagcctaccac
aagtacgatggatttgttgttcttcatggaactgatactcttgcttatactgccagtgca
ctttcattcatgatggaaaatcttggaaaaccagtcattatcacgggaagtcaaattcca
gttgcagaagtacgttctgatggaatggagaatcttatcggagctttgatcaccgcggga
aattttgatattcccgaagtttgtgtttatttcaataacaaactgatgcgtggaaatcga
acagtaaaattggataattctgcccttgaagcttttgacagtccaaatatgcatccatta
gctcagatggctataaatatcaaggttaactacgattccattttccgaagtgacatggtt
gccgctttcactgttcatgagaatctttgccgtgacgtaggaatgcttcgaatttttcca
tcaatgactattgaatcagttcgtgcttttttacaaccaccaacgagggggtgtatttta
caaactttcggatctggaaacatgccaactagacgacaggacattattatggccttgaag
gaagctatagctcgcggtgtgatggttgtgaattgctcacagtgtctgaaaggacaagtt
gatgtcaattatgcaacgggtaaaattttgtacgacatcggagtgatccctggatcggac
atgacctcggaagccgcaatggccaaattatgctacgtgttagggaaagatgaatgggac
ttgccaatgaaaagaagtatgctgcaatcaaatcttcgtggtgaaatgacaattgcttca
aagggagccatgcgtgagcttgatataattcctcatatcgcaaaatgccttcgtgtctct
tcatctcaagaagttcaattgctccgtgacatcattcttccaccaatgttttgtaatgct
gctaagacgaatgacgtagaaattctgaaatcgctgaaagcagccggagtcaatttctcg
gcaactgattacaatcttcgaactgctcttcatgttgctgcctccaatggacatctcgaa
tctgtcaattatttacttaagataggaacgaatgttcacatcaaagatatgtttggatat
aatgcacttgtgtgtgcagtgaaagcaaaagccatggactgtatcattgcgatcagagac
gctggtggattcattgatgcttcagctcaaaaaattggtgtggaactttgtcttgctgtg
taccaaaatgacatggaacttttgaagtgtaatgaggcagccggaactcacatgggcgag
aaggattatgacaatcggacggcgttgcatgtggccgcgtcactgaataagccagagatt
gtcgcctatcttctgcaatgtggtttgaatccacacgaaaaggatgattttggaattaca
cctatggatgaagcgaaacggcgaaacttgcaaaatttaatggatatgatggcggaacac
caagctcttacaaataatgacgaagtattccacttggaatga

DBGET integrated database retrieval system