KEGG   Caenorhabditis elegans (nematode): CELE_C29F3.1Help
Entry
CELE_C29F3.1      CDS       T00019                                 

Gene name
ech-1
Definition
Protein ECH-1
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_C29F3.1 (ech-1)
   01212 Fatty acid metabolism
    CELE_C29F3.1 (ech-1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CELE_C29F3.1 (ech-1)
   00650 Butanoate metabolism
    CELE_C29F3.1 (ech-1)
  Lipid metabolism
   00062 Fatty acid elongation
    CELE_C29F3.1 (ech-1)
   00071 Fatty acid degradation
    CELE_C29F3.1 (ech-1)
   01040 Biosynthesis of unsaturated fatty acids
    CELE_C29F3.1 (ech-1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_C29F3.1 (ech-1)
   00310 Lysine degradation
    CELE_C29F3.1 (ech-1)
   00380 Tryptophan metabolism
    CELE_C29F3.1 (ech-1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_C29F3.1 (ech-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     CELE_C29F3.1 (ech-1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CELE_C29F3.1 (ech-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(15357792..15358083,15358438..15358961,15359010..15359510,15359746..15360486,15360529..15360738))
Genome map
AA seq 755 aa AA seqDB search
MLSRVVHRSSSVFRTNLSFRLFSQSAFAVHSTHRVEKQGDVAVMKIDLPNTTENVLNKAL
FAEMNETLDRLQSDQSVKAIVVMSGKPNSFVAGADIQMFKAEKTAAGVSNLLREGQKQLL
TIELSQKPIVAAIMGSCMGGGLEIALACHYRIAVNDKKTLLGLPEVTLGIMPGDGGTQRL
PKLTTVQNVLDLTLTGKRIKANKAMKIGIVDRVIQPLGDGICTSTETTHKYLEEIAVQSA
RELANGKLKINRDKGFVHNATQAVMTSKFVLDNVILKMAKNKLIKLTNGNYPAPLKILDV
VRTAYLDPKNGYEAEAKAFGELSQTFQSKALFGLFEGSTNAKKNKYGKGLPVNEIAVVGA
GFMGAGIANVTINKGIRTVLLDANQAGVERGQNHVATHLNRQLKRQKISKLEREKIYNHL
VPTIDYSAMKNADVVIEAVFEDLPLKHKVIRQIENVVGPNTIIASNTSALPIKDIAAASS
RSDKVIGMHYFSPVEKMQLLEIITHDGTSKETLATAAQLGLKQGKLVVVVKDCPGFFVVR
CLSPMMSEIVRLLQEGVEPSELDKLTTKFGFPVGAATLADEAGLDVAEHVARYLGTALGP
RVHGGSVDLLSELVRAGHKGRKTSKGIFVYGDGAKGSKKVNQEAAKLFEKYKLTPIKSVS
SPEDRQLRLVSRFVNEALLCLEEGVISSPSDGDIASVFGLGFPPFWGGPFRFVDLYGAGK
LVAAMDRFAGVYESVQFEPCQLLRNHAKSGGQFYS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgttatcacgtgttgttcatagatcgtcttcggtgtttcgaacaaatctctcgtttcgt
ttgttctcacagtctgcattcgccgtgcacagtactcatcgcgttgagaaacaaggtgac
gtggctgtcatgaaaattgatttgccaaacacaacagaaaatgtgctcaataaagcgttg
ttcgcggaaatgaacgaaacattggataggcttcaatctgatcaaagtgtcaaagctatt
gttgtcatgtccggaaaaccaaatagttttgttgctggagctgatattcaaatgtttaaa
gcagaaaaaacagccgctggagtttcaaaccttcttcgtgagggccagaaacaattattg
accatcgagctgagccagaaaccaatagtcgctgcaatcatgggaagctgtatgggaggt
ggacttgaaatcgcccttgcttgtcactaccgcattgctgtgaacgacaaaaagacactc
ttgggacttccagaagtgactcttgggataatgccaggagacggtggaactcaaagacta
ccaaagctaactactgttcagaatgttctcgacttgacattgactggcaagagaatcaag
gcaaataaggctatgaaaattggaattgttgatcgtgttattcaaccacttggggatgga
atttgtacatcaaccgaaaccactcataaatatcttgaagaaatcgcagtgcaatcggca
cgggagcttgccaatggaaaactcaaaattaacagagacaaaggatttgtgcacaatgct
acgcaagcagtcatgactagcaaatttgtactggacaatgtgattctcaagatggctaag
aataagcttattaaactgaccaatgggaactatccggctccactcaagattcttgacgtt
gtccggacggcatacctagacccaaaaaatggatatgaagctgaggctaaggcatttggt
gaactttcacaaactttccaatcaaaagcactttttggactgttcgaaggatcgactaat
gctaaaaagaacaaatacggaaaaggacttccggtcaatgaaatcgctgtcgtcggagct
ggattcatgggagcagggattgcgaatgtaactatcaataagggtattcgaacagttctt
ttggatgccaaccaggcaggcgttgaacgaggacaaaatcacgtggctacacatttgaat
agacagctcaagagacaaaagatttcgaaattggaaagagaaaaaatctacaaccatctt
gtgccaacaattgattattccgccatgaagaatgctgatgtagttattgaggcggttttc
gaagatcttcctctgaagcataaagttattaggcaaatcgaaaacgtcgttggaccaaac
acaatcattgcatccaatacttctgctcttccaatcaaggatattgccgctgcgtcttct
cggtcagataaagttattgggatgcactatttctctccagttgaaaagatgcagttactt
gaaattatcactcatgatggaacatctaaagaaacccttgcaactgctgctcagctagga
ctaaagcaaggaaaactcgtcgtcgtcgtcaaggattgtcccggcttcttcgtcgtccga
tgcctaagcccaatgatgtcggaaatagtccgtctcctccaggaaggtgtcgaaccatct
gaacttgacaaactcacaacgaaattcggattccctgtgggagctgcgacgttggccgac
gaagctggactcgacgtcgcagaacacgtggctcgatatctcggaaccgctttaggtcca
cgtgttcatggaggatcggttgatttgttgtccgaattggtgcgcgctggacataagggg
cgtaagacttcaaagggaatctttgtgtacggagatggggcaaaaggcagcaagaaagta
aaccaagaggcggcaaagctgtttgaaaagtataaattgacaccaatcaaatctgtctca
tctcctgaggaccgtcaacttcgtctcgtctctcgatttgtcaatgaggcacttctttgt
cttgaagaaggtgttattagctcaccatctgacggagatatagcctctgtatttggtctc
ggtttcccaccattctggggaggcccattccggtttgtcgatctttatggagcgggcaag
ttggttgcggcgatggacaggtttgccggagtgtacgaatctgtccaatttgagccatgc
caacttctcagaaatcatgcgaagagtggaggacaattttatagctaa

DBGET integrated database retrieval system