KEGG   Caenorhabditis elegans (nematode): CELE_C30H6.7Help
Entry
CELE_C30H6.7      CDS       T00019                                 

Gene name
C30H6.7
Definition
Protein C30H6.7, isoform A
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cel01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cel00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cel00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cel00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(17380598..17380653,17380698..17380896,17380942..17381046,17381092..17381229,17381274..17381494,17381730..17381867,17381954..17382110)
Genome map
AA seq 337 aa AA seqDB search
MLAGSQALRHLSTAAQNQGACGPAVKLLLIQYGLENRKIDGTGPKNKNILKGDVMKIVEA
EKLKPVAHHAHAPKETHIENKSIEKKSDIFGANNRSLRHHQDIPLSNIRATIAKRLTASK
QQIPHEYQGVDVRIDDILALRQKLKKSGTAVSLNDFIIKAAALALRSVPTVNVRWTPEGI
GLGSVDISVAVATPTGLITPIVENSDILGVLAISSKVKELSGLARESKLKPQQFQGGSFT
ISNLGMFGSVTNFTAIINPPQCAILTIGGTRSEVVSVDGQLETQKLMGVNLCFDGRAISE
ECAKRFLLHFSESLSDPELLIAEPLSPELDFDFSRLL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctagccggtagtcaggctcttcgccacctttctactgctgcacaaaaccaaggagct
tgcggtcctgcagtcaagcttcttctgattcaatatggtctggaaaatcgaaaaattgat
ggaacaggcccaaaaaacaaaaatattctgaaaggcgatgttatgaaaatagttgaagct
gaaaagctgaagccggtggctcatcatgcacatgctccaaaagaaacacatattgaaaat
aaatctattgaaaagaaatcagacattttcggcgccaacaatcgcagtctccgtcatcac
caagatattcctctcagcaatattcgagcaacaatcgcaaaacgattgacagcttctaaa
cagcaaattcctcacgaatatcaaggtgttgacgttcgaattgacgatattctggcgttg
agacagaaattgaaaaaatccggaactgctgtttcgctcaacgactttatcataaaagcc
gcagcccttgcactgaggtccgtgccgacagtaaatgttcgatggactccagaaggaatc
ggtctcggatcagtcgatatttcggtcgctgtggctactccaaccggccttatcactcca
attgtagagaattctgatattttgggcgttttggcgatttctagcaaagtgaaggagttg
tcgggattggcgcgagaaagcaaattaaaaccacaacagttccagggaggatcttttaca
atttcgaatcttggaatgttcggaagtgtgaccaacttcacagccatcataaatccaccg
caatgtgccattttgacgatcggaggaactcgttctgaagttgtatctgttgatggacaa
ttggagacacaaaaattaatgggtgtcaatctttgtttcgacggacgagcaatctccgaa
gaatgtgcaaaacgattccttcttcacttctccgaatcgctttctgatccggaattgctc
attgctgaaccactttctccagaactcgattttgatttttcgcgtttattgtag

DBGET integrated database retrieval system