KEGG   Caenorhabditis elegans (nematode): CELE_C30H6.7Help
Entry
CELE_C30H6.7      CDS       T00019                                 

Gene name
C30H6.7
Definition
Protein C30H6.7, isoform A
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_C30H6.7 (C30H6.7)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_C30H6.7 (C30H6.7)
   00020 Citrate cycle (TCA cycle)
    CELE_C30H6.7 (C30H6.7)
   00620 Pyruvate metabolism
    CELE_C30H6.7 (C30H6.7)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CELE_C30H6.7 (C30H6.7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(17380635..17380690,17380735..17380933,17380979..17381083,17381129..17381266,17381311..17381531,17381767..17381904,17381991..17382147)
Genome map
AA seq 337 aa AA seqDB search
MLAGSQALRHLSTAAQNQGACGPAVKLLLIQYGLENRKIDGTGPKNKNILKGDVMKIVEA
EKLKPVAHHAHAPKETHIENKSIEKKSDIFGANNRSLRHHQDIPLSNIRATIAKRLTASK
QQIPHEYQGVDVRIDDILALRQKLKKSGTAVSLNDFIIKAAALALRSVPTVNVRWTPEGI
GLGSVDISVAVATPTGLITPIVENSDILGVLAISSKVKELSGLARESKLKPQQFQGGSFT
ISNLGMFGSVTNFTAIINPPQCAILTIGGTRSEVVSVDGQLETQKLMGVNLCFDGRAISE
ECAKRFLLHFSESLSDPELLIAEPLSPELDFDFSRLL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctagccggtagtcaggctcttcgccacctttctactgctgcacaaaaccaaggagct
tgcggtcctgcagtcaagcttcttctgattcaatatggtctggaaaatcgaaaaattgat
ggaacaggcccaaaaaacaaaaatattctgaaaggcgatgttatgaaaatagttgaagct
gaaaagctgaagccggtggctcatcatgcacatgctccaaaagaaacacatattgaaaat
aaatctattgaaaagaaatcagacattttcggcgccaacaatcgcagtctccgtcatcac
caagatattcctctcagcaatattcgagcaacaatcgcaaaacgattgacagcttctaaa
cagcaaattcctcacgaatatcaaggtgttgacgttcgaattgacgatattctggcgttg
agacagaaattgaaaaaatccggaactgctgtttcgctcaacgactttatcataaaagcc
gcagcccttgcactgaggtccgtgccgacagtaaatgttcgatggactccagaaggaatc
ggtctcggatcagtcgatatttcggtcgctgtggctactccaaccggccttatcactcca
attgtagagaattctgatattttgggcgttttggcgatttctagcaaagtgaaggagttg
tcgggattggcgcgagaaagcaaattaaaaccacaacagttccagggaggatcttttaca
atttcgaatcttggaatgttcggaagtgtgaccaacttcacagccatcataaatccaccg
caatgtgccattttgacgatcggaggaactcgttctgaagttgtatctgttgatggacaa
ttggagacacaaaaattaatgggtgtcaatctttgtttcgacggacgagcaatctccgaa
gaatgtgcaaaacgattccttcttcacttctccgaatcgctttctgatccggaattgctc
attgctgaaccactttctccagaactcgattttgatttttcgcgtttattgtag

DBGET integrated database retrieval system