KEGG   Caenorhabditis elegans (nematode): CELE_C33C12.3Help
Entry
CELE_C33C12.3     CDS       T00019                                 

Gene name
gba-1
Definition
(RefSeq) GBA-1, isoform A
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_C33C12.3 (gba-1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_C33C12.3 (gba-1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_C33C12.3 (gba-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_C33C12.3 (gba-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:join(2176947..2177001,2177052..2177134,2177737..2177842,2178036..2178188,2178536..2178669,2178718..2178790,2179357..2179453,2179503..2179743,2180272..2180403,2180454..2180540,2180670..2180833,2181590..2181716,2181766..2181885)
Genome map
AA seq 523 aa AA seqDB search
MKSRFLLKIFIFLAVFGVDSVRAADCTEKTFKTGTVCVCSLDSCDEIPPLDITMGQAALY
TTSHTGARLHRDVIYATDTEPFGTLHMTIDSSKKYQTIQGFGSTFSDASGANLKSLPDKL
SDLIMKQYFSDTGLNLQFGRVPIASTDFSGRVYSYNDVANDYSMQNFNLTKEDFQWKIPY
IKNAQKYNPNLKLFAAPWAAPGWLKTTKEMTGPGALNGKAGDNYHQAYAKYFVRFLEEYG
KSGISFWGLSTQNQPTLGSDKKNKIQSTLFTAETQRDFIKTDLGPALAASSSGKDVKLLI
LDDNRGNLPKWADTVLNDMDAAKYVGGIGVHAYQDGETDNHLDETHKKHPNFFILGTEAS
EGYGSKDTHVDYGNWDRAADTASDILDNMNNWMTGWTERNLILDALGGPSWVSDYTDAPV
IAFPAMAQFYKQPMFYAIAHFSHFIKPGAVRIDHSLNVIELEVETTAFLNPDGSKVIVML
NKGSLVSTEHTVVVQDAADSRNHYHFTLPHRAITTLYIQTSQF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacgatttttattgaaaatcttcatatttttagcggtttttggagttgatagt
gtccgggcagctgattgtacggaaaaaacatttaaaaccggaacagtatgcgtttgtagt
ctcgattcttgcgatgagattccacctctggacatcactatgggtcaggcggcactctac
accacctcccataccggcgcccggctccacagggatgtcatctatgcgacggatactgag
ccattcggaaccctgcacatgacaattgactcctccaaaaaataccagacgatccaagga
tttggctccacattttccgatgcttctggtgcaaacctgaagagtttgccggacaaattg
tcggatttgattatgaaacaatatttttcggatacaggacttaacctccaattcggtaga
gttccaatagccagcacagatttttcgggtcgagtttacagttataacgatgtcgcaaat
gattattcaatgcagaattttaatttgactaaggaagatttccagtggaaaatcccatac
atcaaaaacgcgcagaagtacaatccgaacttgaagttatttgcagctccgtgggcagca
ccaggatggcttaagactactaaagaaatgacaggacctggggctcttaacggaaaagct
ggggataactatcatcaggcatacgccaaatattttgtcagattcctcgaggagtacgga
aaatctggaatctcattctggggactttcaactcaaaaccagccaacattaggctccgat
aagaagaataaaatacaatcgacacttttcacagctgaaacacaacgagatttcataaaa
actgacttgggaccagccctggctgcttcaagttctggaaaagatgtgaaacttctgatt
ctggacgataatcgaggaaacttgccgaaatgggcagatactgttctaaacgacatggac
gccgcaaagtacgtgggcggtatcggggttcacgcatatcaagacggagaaactgataat
cacttggatgagactcacaaaaaacatccaaatttttttattttaggcactgaggcttcc
gaaggctacgggtccaaggacacccacgtggattatggaaattgggatcgtgcagcagat
actgcttcagatattttagataacatgaacaactggatgactggctggacagaacgtaac
ctaatcctagacgccctgggtggtccatcatgggtgtccgactacacagatgcgccggtc
attgcgttcccagcgatggctcaattctacaagcagcccatgttttatgcgattgcacat
tttagtcacttcatcaagcctggagcagtaagaatcgaccactcattaaatgtaattgag
ctggaagttgaaaccaccgcatttttgaatcctgatggctcaaaagttattgtaatgctc
aataagggctcgctagtctcaacggagcacacagtagttgtccaggatgctgctgatagc
cgtaatcactatcattttacacttccacatcgagctattaccactttgtatattcaaact
tcacagttttag

DBGET integrated database retrieval system