KEGG   Caenorhabditis elegans (nematode): CELE_C33C12.3Help
Entry
CELE_C33C12.3     CDS       T00019                                 

Gene name
gba-1
Definition
Protein GBA-1, isoform A
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_C33C12.3 (gba-1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_C33C12.3 (gba-1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_C33C12.3 (gba-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_C33C12.3 (gba-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:join(2176952..2177006,2177057..2177139,2177742..2177847,2178041..2178193,2178541..2178674,2178723..2178795,2179362..2179458,2179508..2179748,2180277..2180408,2180459..2180545,2180675..2180838,2181595..2181721,2181771..2181890)
Genome map
AA seq 523 aa AA seqDB search
MKSRFLLKIFIFLAVFGVDSVRAADCTEKTFKTGTVCVCSLDSCDEIPPLDITMGQAALY
TTSHTGARLHRDVIYATDTEPFGTLHMTIDSSKKYQTIQGFGSTFSDASGANLKSLPDKL
SDLIMKQYFSDTGLNLQFGRVPIASTDFSGRVYSYNDVANDYSMQNFNLTKEDFQWKIPY
IKNAQKYNPNLKLFAAPWAAPGWLKTTKEMTGPGALNGKAGDNYHQAYAKYFVRFLEEYG
KSGISFWGLSTQNQPTLGSDKKNKIQSTLFTAETQRDFIKTDLGPALAASSSGKDVKLLI
LDDNRGNLPKWADTVLNDMDAAKYVGGIGVHAYQDGETDNHLDETHKKHPNFFILGTEAS
EGYGSKDTHVDYGNWDRAADTASDILDNMNNWMTGWTERNLILDALGGPSWVSDYTDAPV
IAFPAMAQFYKQPMFYAIAHFSHFIKPGAVRIDHSLNVIELEVETTAFLNPDGSKVIVML
NKGSLVSTEHTVVVQDAADSRNHYHFTLPHRAITTLYIQTSQF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacgatttttattgaaaatcttcatatttttagcggtttttggagttgatagt
gtccgggcagctgattgtacggaaaaaacatttaaaaccggaacagtatgcgtttgtagt
ctcgattcttgcgatgagattccacctctggacatcactatgggtcaggcggcactctac
accacctcccataccggcgcccggctccacagggatgtcatctatgcgacggatactgag
ccattcggaaccctgcacatgacaattgactcctccaaaaaataccagacgatccaagga
tttggctccacattttccgatgcttctggtgcaaacctgaagagtttgccggacaaattg
tcggatttgattatgaaacaatatttttcggatacaggacttaacctccaattcggtaga
gttccaatagccagcacagatttttcgggtcgagtttacagttataacgatgtcgcaaat
gattattcaatgcagaattttaatttgactaaggaagatttccagtggaaaatcccatac
atcaaaaacgcgcagaagtacaatccgaacttgaagttatttgcagctccgtgggcagca
ccaggatggcttaagactactaaagaaatgacaggacctggggctcttaacggaaaagct
ggggataactatcatcaggcatacgccaaatattttgtcagattcctcgaggagtacgga
aaatctggaatctcattctggggactttcaactcaaaaccagccaacattaggctccgat
aagaagaataaaatacaatcgacacttttcacagctgaaacacaacgagatttcataaaa
actgacttgggaccagccctggctgcttcaagttctggaaaagatgtgaaacttctgatt
ctggacgataatcgaggaaacttgccgaaatgggcagatactgttctaaacgacatggac
gccgcaaagtacgtgggcggtatcggggttcacgcatatcaagacggagaaactgataat
cacttggatgagactcacaaaaaacatccaaatttttttattttaggcactgaggcttcc
gaaggctacgggtccaaggacacccacgtggattatggaaattgggatcgtgcagcagat
actgcttcagatattttagataacatgaacaactggatgactggctggacagaacgtaac
ctaatcctagacgccctgggtggtccatcatgggtgtccgactacacagatgcgccggtc
attgcgttcccagcgatggctcaattctacaagcagcccatgttttatgcgattgcacat
tttagtcacttcatcaagcctggagcagtaagaatcgaccactcattaaatgtaattgag
ctggaagttgaaaccaccgcatttttgaatcctgatggctcaaaagttattgtaatgctc
aataagggctcgctagtctcaacggagcacacagtagttgtccaggatgctgctgatagc
cgtaatcactatcattttacacttccacatcgagctattaccactttgtatattcaaact
tcacagttttag

DBGET integrated database retrieval system