KEGG   Caenorhabditis elegans (nematode): CELE_C33C12.8Help
Entry
CELE_C33C12.8     CDS       T00019                                 

Gene name
gba-2
Definition
Protein GBA-2
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_C33C12.8 (gba-2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CELE_C33C12.8 (gba-2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CELE_C33C12.8 (gba-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CELE_C33C12.8 (gba-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(2182518..2182749,2183259..2183422,2183470..2183550,2183651..2183782,2184051..2184388,2184715..2184787,2184830..2184963,2185363..2185515,2185566..2185769,2186382..2186421))
Genome map
AA seq 516 aa AA seqDB search
MSIAWSCFVLGLFALASLQVALANDCAQKTFKTGIVCVCNITYCDEIPDINLLSGQAATF
TTSKSGARLHRDVVYATNSDPLTSMHFTIDSSKTYQTIQGFGSTFSDASGANLKSLPDQM
ADTILRQYFSDSGLNLQFGRVPIASNDFSSRVYTYDDNLEDYNMAHFSLQREDYQWKIPY
MQMAQKYNHDLKFFAVPWSAPGWLKTTNSTKGYGILLGTNQDTYHKSYVTYILHFLEEYQ
KNGILFWGLSTQNEPTSGSDKKTKMQSMGFTAEFQRDFIKLDIGPALKSSNAGKNVKILI
LDDNRGNLPKWADTVLNDKDAASYVSGIAVHSYQDDESDKHLTQTHNNHPDVFIFGTEAS
EGSKSKDVDYGSFDRAEDYVSDILDDFNNWVTGWTERNLVLDAQGGPSWVSGFADAPVIA
FPALAQFYKQPMFYAIAHFSHFLKPGAVRIDHSLNMPNPEIERSAFLNPDGSKVVVLHNK
NPLAPYSLSIKDTMKSTDHYQVHLSPKTIVTLYIQN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagcctggagttgctttgttttagggctttttgccctcgcctccctccaggtg
gcactcgccaatgattgcgcccaaaaaaccttcaaaaccggaattgtgtgtgtctgcaac
ataacttattgcgatgagatcccagatatcaacttactatccgggcaggctgccacattc
acaacttccaaatccggagcccgactgcatcgggatgtggtttatgcgacaaatagtgac
cctttaaccagcatgcacttcacaattgactcgtcaaaaacatatcagacaatccaagga
tttggctcaacgttttccgatgcttctggtgcgaatttgaagagcttacccgatcagatg
gctgatacaattctgagacagtatttttcggattctggcctgaacctgcaattcggacgg
gttccaattgccagcaatgacttttcaagtcgtgtctacacttatgacgataaccttgaa
gactacaatatggcacattttagcctgcaaagggaagactatcagtggaagattccgtat
atgcaaatggcgcagaagtacaaccacgatttgaagtttttcgccgtgccgtggagtgcg
ccaggctggctaaaaaccacgaattccaccaaagggtacggtatcctactaggcaccaat
caagacacctaccacaaatcctacgtcacttatatcttacatttcttggaagaatatcag
aaaaatgggattctcttctggggcttgtcaactcaaaatgagccaactagcggaagtgat
aagaagactaaaatgcaatcaatgggattcacggcggaatttcaaagagattttattaag
cttgacattggaccagcgctgaaatcttcgaatgctggaaaaaatgtgaaaattctgatt
ttggacgataatcgtggaaacttgccaaaatgggcagacactgttctcaatgacaaggac
gcagcaagttacgtctccggaatcgccgtacactcttaccaggacgacgaaagtgacaaa
catcttacacaaacccacaataaccacccagatgtgttcatttttggtacagaggcaagc
gaggggtctaaatcgaaggatgtggattatggtagcttcgatcgagcagaagactatgtt
tcggacattttagatgatttcaataattgggttaccggatggacggagcgtaacctggtg
ctagatgctcaaggtggaccgtcctgggtttcgggattcgcggatgctccggtcattgcg
ttccccgcattggctcaattctacaagcagcccatgttttatgcaattgcacattttagt
cattttctgaagcccggagcagttcgaatcgaccattcactgaacatgccaaacccagaa
attgaacgaagtgcatttttgaatccggatggctcaaaagtcgtggtgctccataataaa
aatcctttggcaccatatagtttatcaattaaggatactatgaagtctactgatcattat
caagttcatttatcacctaaaacaattgttacgttgtatattcaaaattag

DBGET integrated database retrieval system