KEGG   Caenorhabditis elegans (nematode): CELE_C33C12.8Help
Entry
CELE_C33C12.8     CDS       T00019                                 

Gene name
gba-2
Definition
Protein GBA-2
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cel00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cel00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cel04142]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II:complement(join(2182523..2182754,2183264..2183427,2183475..2183555,2183656..2183787,2184056..2184393,2184720..2184792,2184835..2184968,2185368..2185520,2185571..2185774,2186387..2186426))
Genome map
AA seq 516 aa AA seqDB search
MSIAWSCFVLGLFALASLQVALANDCAQKTFKTGIVCVCNITYCDEIPDINLLSGQAATF
TTSKSGARLHRDVVYATNSDPLTSMHFTIDSSKTYQTIQGFGSTFSDASGANLKSLPDQM
ADTILRQYFSDSGLNLQFGRVPIASNDFSSRVYTYDDNLEDYNMAHFSLQREDYQWKIPY
MQMAQKYNHDLKFFAVPWSAPGWLKTTNSTKGYGILLGTNQDTYHKSYVTYILHFLEEYQ
KNGILFWGLSTQNEPTSGSDKKTKMQSMGFTAEFQRDFIKLDIGPALKSSNAGKNVKILI
LDDNRGNLPKWADTVLNDKDAASYVSGIAVHSYQDDESDKHLTQTHNNHPDVFIFGTEAS
EGSKSKDVDYGSFDRAEDYVSDILDDFNNWVTGWTERNLVLDAQGGPSWVSGFADAPVIA
FPALAQFYKQPMFYAIAHFSHFLKPGAVRIDHSLNMPNPEIERSAFLNPDGSKVVVLHNK
NPLAPYSLSIKDTMKSTDHYQVHLSPKTIVTLYIQN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagcctggagttgctttgttttagggctttttgccctcgcctccctccaggtg
gcactcgccaatgattgcgcccaaaaaaccttcaaaaccggaattgtgtgtgtctgcaac
ataacttattgcgatgagatcccagatatcaacttactatccgggcaggctgccacattc
acaacttccaaatccggagcccgactgcatcgggatgtggtttatgcgacaaatagtgac
cctttaaccagcatgcacttcacaattgactcgtcaaaaacatatcagacaatccaagga
tttggctcaacgttttccgatgcttctggtgcgaatttgaagagcttacccgatcagatg
gctgatacaattctgagacagtatttttcggattctggcctgaacctgcaattcggacgg
gttccaattgccagcaatgacttttcaagtcgtgtctacacttatgacgataaccttgaa
gactacaatatggcacattttagcctgcaaagggaagactatcagtggaagattccgtat
atgcaaatggcgcagaagtacaaccacgatttgaagtttttcgccgtgccgtggagtgcg
ccaggctggctaaaaaccacgaattccaccaaagggtacggtatcctactaggcaccaat
caagacacctaccacaaatcctacgtcacttatatcttacatttcttggaagaatatcag
aaaaatgggattctcttctggggcttgtcaactcaaaatgagccaactagcggaagtgat
aagaagactaaaatgcaatcaatgggattcacggcggaatttcaaagagattttattaag
cttgacattggaccagcgctgaaatcttcgaatgctggaaaaaatgtgaaaattctgatt
ttggacgataatcgtggaaacttgccaaaatgggcagacactgttctcaatgacaaggac
gcagcaagttacgtctccggaatcgccgtacactcttaccaggacgacgaaagtgacaaa
catcttacacaaacccacaataaccacccagatgtgttcatttttggtacagaggcaagc
gaggggtctaaatcgaaggatgtggattatggtagcttcgatcgagcagaagactatgtt
tcggacattttagatgatttcaataattgggttaccggatggacggagcgtaacctggtg
ctagatgctcaaggtggaccgtcctgggtttcgggattcgcggatgctccggtcattgcg
ttccccgcattggctcaattctacaagcagcccatgttttatgcaattgcacattttagt
cattttctgaagcccggagcagttcgaatcgaccattcactgaacatgccaaacccagaa
attgaacgaagtgcatttttgaatccggatggctcaaaagtcgtggtgctccataataaa
aatcctttggcaccatatagtttatcaattaaggatactatgaagtctactgatcattat
caagttcatttatcacctaaaacaattgttacgttgtatattcaaaattag

DBGET integrated database retrieval system