KEGG   Caenorhabditis elegans (nematode): CELE_C34D4.9Help
Entry
CELE_C34D4.9      CDS       T00019                                 

Gene name
nas-8
Definition
Protein NAS-8
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C34D4.9 (nas-8)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C34D4.9 (nas-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(7115650..7115743,7116056..7116127,7116978..7117114,7117834..7117971,7118022..7118104,7118149..7118215,7118324..7118432,7118688..7118765,7118821..7118924,7118979..7119105,7119586..7119788)
Genome map
AA seq 403 aa AA seqDB search
MRRNDLLNNKITIFLSSLSLFVIIIPIYAAEKDLLPPSTSSETFLTDEDFLRPLNDDETF
LTEKDFKNGEKLGEDHVPAGSILWKQVYKKGDIRGKAAWKLDPKNSESLRRNGVITGTRK
WPNGRIPYVISNQYNDRERAVLARSFQAYHDKTCVRFVPRTAVDNDYLYIGKIDGCYSDV
GRAGGRQELSLDNGCLQYDTAIHELMHSVGFYHEHERWDRDEHITILWHNIDREAYDQFG
KVDLAESSYYGQLYDYYSIMHYDSLAFSKNGFETMVAKQSEMTAVIGAAIDFSPIDILKM
NLMYQCSDVKLPPTVVGTTDKTIVPVPAPSVTVVEDDCRDRTNLCWRWIDRCKSFFFEQI
MKEFCSLSCGYCTPKALQTAKASPPNYSNTLLTKSSTSYLQHG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaatgatctgctgaacaataaaataacaatttttctatcatcactatcactt
tttgtcattattattccaatttatgccgctgaaaaagatctcttgcccccatccacttca
agtgagacattcctaactgatgaagattttttgagacctttgaatgatgacgagacattt
ctgactgagaaagacttcaaaaatggtgagaagctgggtgaagaccacgtgccagctggt
tcaattctctggaaacaagtctataaaaaaggagatatccgaggaaaggctgcctggaaa
ttggatccaaaaaacagcgaaagcttaagaagaaatggagtaattactggtacacgaaaa
tggccaaatggaagaataccttatgtgatatcaaatcaatataatgatagagaacgtgca
gttctagctagaagctttcaggcataccacgacaaaacctgcgttcgatttgttcctaga
accgctgtagacaacgattatttatacattgggaagatcgatggatgttattcggatgtt
ggaagagctggaggcaggcaggagctgtcattggacaatggatgcttgcagtacgacaca
gcaatccacgaactaatgcattcggtaggtttctatcacgaacacgaaagatgggatcga
gacgaacatatcacaattttatggcataatattgatagggaagcgtatgatcagtttgga
aaagttgatttggcggagagctcttattacggacagctttatgattattattctatcatg
cactacgattcattggcattttccaaaaatggtttcgaaactatggttgccaaacaatcc
gaaatgactgctgttattggagcagcaatcgattttagtccgatagacatcttaaaaatg
aatctgatgtaccaatgcagtgatgtgaagcttccaccaactgtagtggggacaactgat
aaaacaattgttccagtgccagctccatcggttacggtagtggaagatgactgtcgtgat
cgaacaaacctttgctggcgttggattgatcgatgcaaatcatttttcttcgagcaaata
atgaaagaattttgctctctttcgtgtggttactgtaccccaaaagctctccaaactgca
aaagcatcaccaccgaactacagtaatacattgctaacaaagtcgagcacttcgtatctg
cagcatggttaa

DBGET integrated database retrieval system