KEGG   Caenorhabditis elegans (nematode): CELE_C34D4.9Help
Entry
CELE_C34D4.9      CDS       T00019                                 

Gene name
nas-8
Definition
Protein NAS-8
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:join(7115638..7115731,7116044..7116115,7116966..7117102,7117822..7117959,7118010..7118092,7118137..7118203,7118312..7118420,7118676..7118753,7118809..7118912,7118967..7119093,7119574..7119776)
Genome map
AA seq 403 aa AA seqDB search
MRRNDLLNNKITIFLSSLSLFVIIIPIYAAEKDLLPPSTSSETFLTDEDFLRPLNDDETF
LTEKDFKNGEKLGEDHVPAGSILWKQVYKKGDIRGKAAWKLDPKNSESLRRNGVITGTRK
WPNGRIPYVISNQYNDRERAVLARSFQAYHDKTCVRFVPRTAVDNDYLYIGKIDGCYSDV
GRAGGRQELSLDNGCLQYDTAIHELMHSVGFYHEHERWDRDEHITILWHNIDREAYDQFG
KVDLAESSYYGQLYDYYSIMHYDSLAFSKNGFETMVAKQSEMTAVIGAAIDFSPIDILKM
NLMYQCSDVKLPPTVVGTTDKTIVPVPAPSVTVVEDDCRDRTNLCWRWIDRCKSFFFEQI
MKEFCSLSCGYCTPKALQTAKASPPNYSNTLLTKSSTSYLQHG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaatgatctgctgaacaataaaataacaatttttctatcatcactatcactt
tttgtcattattattccaatttatgccgctgaaaaagatctcttgcccccatccacttca
agtgagacattcctaactgatgaagattttttgagacctttgaatgatgacgagacattt
ctgactgagaaagacttcaaaaatggtgagaagctgggtgaagaccacgtgccagctggt
tcaattctctggaaacaagtctataaaaaaggagatatccgaggaaaggctgcctggaaa
ttggatccaaaaaacagcgaaagcttaagaagaaatggagtaattactggtacacgaaaa
tggccaaatggaagaataccttatgtgatatcaaatcaatataatgatagagaacgtgca
gttctagctagaagctttcaggcataccacgacaaaacctgcgttcgatttgttcctaga
accgctgtagacaacgattatttatacattgggaagatcgatggatgttattcggatgtt
ggaagagctggaggcaggcaggagctgtcattggacaatggatgcttgcagtacgacaca
gcaatccacgaactaatgcattcggtaggtttctatcacgaacacgaaagatgggatcga
gacgaacatatcacaattttatggcataatattgatagggaagcgtatgatcagtttgga
aaagttgatttggcggagagctcttattacggacagctttatgattattattctatcatg
cactacgattcattggcattttccaaaaatggtttcgaaactatggttgccaaacaatcc
gaaatgactgctgttattggagcagcaatcgattttagtccgatagacatcttaaaaatg
aatctgatgtaccaatgcagtgatgtgaagcttccaccaactgtagtggggacaactgat
aaaacaattgttccagtgccagctccatcggttacggtagtggaagatgactgtcgtgat
cgaacaaacctttgctggcgttggattgatcgatgcaaatcatttttcttcgagcaaata
atgaaagaattttgctctctttcgtgtggttactgtaccccaaaagctctccaaactgca
aaagcatcaccaccgaactacagtaatacattgctaacaaagtcgagcacttcgtatctg
cagcatggttaa

DBGET integrated database retrieval system