KEGG   Caenorhabditis elegans (nematode): CELE_C34G6.2Help
Entry
CELE_C34G6.2      CDS       T00019                                 

Gene name
tyr-4
Definition
Protein TYR-4
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_C34G6.2 (tyr-4)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CELE_C34G6.2 (tyr-4)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CELE_C34G6.2 (tyr-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(5898321..5898458,5898939..5899068,5899203..5899333,5899378..5899589,5899667..5900128,5900175..5900267,5900525..5900859,5901227..5901556,5901610..5902034)
Genome map
AA seq 751 aa AA seqDB search
MRFLIPIIFTTLPLCLQAQEDPCASAPSEAAKIMCKQIHRWDDGARAASKKKKIALPPGM
AKGMAAEFAPIASNIYQCMDLPCLCSYLRGTASGNGCTLPNGRPLQKSVRKEYRTLTDDE
RNRLHAAFRALKNNGEYERIGRIHSQMSAAGGAHSGPAFLPWHREFVKRVEFALRQVDPT
VNLPYWDSTLDSRLPRPADTIMFSDYLMGSTGLVNDGPFTNWRTLAGRAQILRAVGAQGA
PLSQNDIDFVMRQTQIDQVLSFTAPQQGCPYRTDFNCLEYTHGNVHIFVGGDMFDTATSS
NDPSFFLHHAFIDFVWEEWRLARQSRADREIAFPPDNQLCASAQHFGASPMQPFSPMRNI
DGLSNKYTDNLYSYAPRPTCQAGGDCGSKFLFCDTSTGAARCVSRIRPGSQCGQFRVNPC
FSGICQNGVCVLSSTAPRPTPAPTTPTPQNPVQSQESCFNENQCCASWAASGECSRNTAY
MNEWCKASCGVCKPKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSR
AQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCG
HCYPEDYNYGSCVDYHRSCAGWARVGECQKNPWMAENCRSSCNSCYTQSELRRMCGTTAG
SVAPVAQVRQTNPSRQPPRGGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWG
GGGWGGGGWGKRSIRAANASISMPSFDPDLL
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttttgatacccataatctttacaacattaccattatgtttacaagcacaagaa
gatccatgtgcaagtgctccatcagaagcagcaaaaattatgtgcaagcagattcacaga
tgggatgatggagcaagggcggcatcaaagaaaaagaaaattgcattaccaccaggaatg
gcaaagggaatggcagctgagtttgctccaattgcttcaaatatctaccagtgcatggat
ttaccctgcttgtgttcttatttgagaggaactgcgtctggaaacggttgtactcttcca
aatggaaggccacttcaaaaatcagtgagaaaagagtaccgtactctcacagatgatgaa
cgaaatagacttcacgcagcattccgtgctctcaaaaataatggtgaatacgaaagaatt
ggaagaattcactcacaaatgtctgctgccggaggagctcattctggaccagcattcctt
ccgtggcatcgtgaatttgtgaaacgtgtcgagtttgctctacgccaagttgatccaacg
gttaatcttccatattgggattctacgttggatagtagactgccacgtcctgcagatact
attatgttcagtgactatcttatgggaagtaccggacttgttaatgatggacccttcaca
aattggcgaactttggctggaagagcccaaatactgagagccgtcggagcacaaggagct
ccactttcacaaaatgatattgattttgtaatgagacagacacaaattgatcaagtatta
tcgtttactgcaccacaacaaggatgcccatatagaactgatttcaattgtcttgaatat
actcatggaaatgttcacatttttgttggaggagatatgttcgacactgcaacttcttca
aatgatccttcatttttccttcatcatgcatttattgattttgtatgggaagaatggaga
ttggcaagacaatcaagagctgatcgggaaattgcattccctcctgataatcaattatgt
gcttctgcacaacattttggagcatctccaatgcagccgttcagtccaatgagaaatatc
gatggtttatccaataaatatacagataacttgtatagttatgcaccacggccaacatgt
caagctggaggcgattgcggttctaaattccttttctgtgacacttccaccggggccgcc
cgttgtgtatctcgtattcgtccaggatctcaatgtggtcaattccgtgtgaatccatgt
ttctcaggaatctgccaaaacggtgtatgtgttctctcatcaacagctccacgtccaaca
cctgctccaacaactccaacacctcaaaatccagtacaatctcaagaatcatgtttcaat
gagaatcagtgttgtgcatcatgggcagcatctggggaatgttcgaggaatacggcttat
atgaatgaatggtgtaaggccagttgtggtgtttgtaaacccaaatatcgactggctgat
gattgcactgatcgtcatacccaatgcagtagctggtcccgctccggtgaatgcaccaaa
aatcaactctggatgactgaaaattgccgtaaaagttgtaataaatgtggtagatcacgt
gctcaagagtgtggaggaggtggtactacagtaaccacgacgacacctgctccagctcaa
cagtgtgataattctgatggttgtttcaatgagaatgtttgctgtgctgtatggggatta
atgggagaatgccgaaaaaatacaagatatatggcatgtaattgtcgagtttcatgtgga
cattgctatcctgaagattacaattatggatcatgcgtcgactaccatagatcatgtgcc
ggatgggctcgtgtcggtgaatgtcagaaaaatccatggatggctgagaattgtagatca
agctgtaacagttgctatactcaatcagagcttcgtagaatgtgtggaactacagctgga
tcagttgctccagttgcacaagttcgtcagactaatccatctcgtcaaccaccacgtgga
ggttggggacgtgacgatttcggagataatggaggatggggtggaaatggaggtggtgga
tggggaaacaatgatccatggggaggatcaagatggggtggtggaagaggtggatggggt
ggaggtggatggggaggcggtggatggggtaaacgatccattcgagcagccaatgcatca
atttcaatgccatcttttgatccggacctcttgtaa

DBGET integrated database retrieval system