KEGG   Caenorhabditis elegans (nematode): CELE_C34G6.2Help
Entry
CELE_C34G6.2      CDS       T00019                                 

Gene name
tyr-4
Definition
Protein TYR-4
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cel00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:cel00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(5898324..5898461,5898942..5899071,5899206..5899336,5899381..5899592,5899670..5900131,5900178..5900270,5900528..5900862,5901230..5901559,5901613..5902037)
Genome map
AA seq 751 aa AA seqDB search
MRFLIPIIFTTLPLCLQAQEDPCASAPSEAAKIMCKQIHRWDDGARAASKKKKIALPPGM
AKGMAAEFAPIASNIYQCMDLPCLCSYLRGTASGNGCTLPNGRPLQKSVRKEYRTLTDDE
RNRLHAAFRALKNNGEYERIGRIHSQMSAAGGAHSGPAFLPWHREFVKRVEFALRQVDPT
VNLPYWDSTLDSRLPRPADTIMFSDYLMGSTGLVNDGPFTNWRTLAGRAQILRAVGAQGA
PLSQNDIDFVMRQTQIDQVLSFTAPQQGCPYRTDFNCLEYTHGNVHIFVGGDMFDTATSS
NDPSFFLHHAFIDFVWEEWRLARQSRADREIAFPPDNQLCASAQHFGASPMQPFSPMRNI
DGLSNKYTDNLYSYAPRPTCQAGGDCGSKFLFCDTSTGAARCVSRIRPGSQCGQFRVNPC
FSGICQNGVCVLSSTAPRPTPAPTTPTPQNPVQSQESCFNENQCCASWAASGECSRNTAY
MNEWCKASCGVCKPKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSR
AQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCG
HCYPEDYNYGSCVDYHRSCAGWARVGECQKNPWMAENCRSSCNSCYTQSELRRMCGTTAG
SVAPVAQVRQTNPSRQPPRGGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWG
GGGWGGGGWGKRSIRAANASISMPSFDPDLL
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttttgatacccataatctttacaacattaccattatgtttacaagcacaagaa
gatccatgtgcaagtgctccatcagaagcagcaaaaattatgtgcaagcagattcacaga
tgggatgatggagcaagggcggcatcaaagaaaaagaaaattgcattaccaccaggaatg
gcaaagggaatggcagctgagtttgctccaattgcttcaaatatctaccagtgcatggat
ttaccctgcttgtgttcttatttgagaggaactgcgtctggaaacggttgtactcttcca
aatggaaggccacttcaaaaatcagtgagaaaagagtaccgtactctcacagatgatgaa
cgaaatagacttcacgcagcattccgtgctctcaaaaataatggtgaatacgaaagaatt
ggaagaattcactcacaaatgtctgctgccggaggagctcattctggaccagcattcctt
ccgtggcatcgtgaatttgtgaaacgtgtcgagtttgctctacgccaagttgatccaacg
gttaatcttccatattgggattctacgttggatagtagactgccacgtcctgcagatact
attatgttcagtgactatcttatgggaagtaccggacttgttaatgatggacccttcaca
aattggcgaactttggctggaagagcccaaatactgagagccgtcggagcacaaggagct
ccactttcacaaaatgatattgattttgtaatgagacagacacaaattgatcaagtatta
tcgtttactgcaccacaacaaggatgcccatatagaactgatttcaattgtcttgaatat
actcatggaaatgttcacatttttgttggaggagatatgttcgacactgcaacttcttca
aatgatccttcatttttccttcatcatgcatttattgattttgtatgggaagaatggaga
ttggcaagacaatcaagagctgatcgggaaattgcattccctcctgataatcaattatgt
gcttctgcacaacattttggagcatctccaatgcagccgttcagtccaatgagaaatatc
gatggtttatccaataaatatacagataacttgtatagttatgcaccacggccaacatgt
caagctggaggcgattgcggttctaaattccttttctgtgacacttccaccggggccgcc
cgttgtgtatctcgtattcgtccaggatctcaatgtggtcaattccgtgtgaatccatgt
ttctcaggaatctgccaaaacggtgtatgtgttctctcatcaacagctccacgtccaaca
cctgctccaacaactccaacacctcaaaatccagtacaatctcaagaatcatgtttcaat
gagaatcagtgttgtgcatcatgggcagcatctggggaatgttcgaggaatacggcttat
atgaatgaatggtgtaaggccagttgtggtgtttgtaaacccaaatatcgactggctgat
gattgcactgatcgtcatacccaatgcagtagctggtcccgctccggtgaatgcaccaaa
aatcaactctggatgactgaaaattgccgtaaaagttgtaataaatgtggtagatcacgt
gctcaagagtgtggaggaggtggtactacagtaaccacgacgacacctgctccagctcaa
cagtgtgataattctgatggttgtttcaatgagaatgtttgctgtgctgtatggggatta
atgggagaatgccgaaaaaatacaagatatatggcatgtaattgtcgagtttcatgtgga
cattgctatcctgaagattacaattatggatcatgcgtcgactaccatagatcatgtgcc
ggatgggctcgtgtcggtgaatgtcagaaaaatccatggatggctgagaattgtagatca
agctgtaacagttgctatactcaatcagagcttcgtagaatgtgtggaactacagctgga
tcagttgctccagttgcacaagttcgtcagactaatccatctcgtcaaccaccacgtgga
ggttggggacgtgacgatttcggagataatggaggatggggtggaaatggaggtggtgga
tggggaaacaatgatccatggggaggatcaagatggggtggtggaagaggtggatggggt
ggaggtggatggggaggcggtggatggggtaaacgatccattcgagcagccaatgcatca
atttcaatgccatcttttgatccggacctcttgtaa

DBGET integrated database retrieval system