KEGG   Caenorhabditis elegans (nematode): CELE_C35A5.9Help
Entry
CELE_C35A5.9      CDS       T00019                                 

Gene name
hda-11
Definition
Protein HDA-11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CELE_C35A5.9 (hda-11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10526310..10526320,10526389..10526613,10526811..10526921,10526968..10527059,10527126..10527238,10527795..10527949,10527998..10528136,10528238..10528396)
Genome map
AA seq 334 aa AA seqDB search
MAERDKDEIFSLKSYQRPIVYHSEYNVTAFGIEHLHPFDSSKWRRVITHLKEMNLITDET
LVEPNLPTFEELTRVHDRKYLKSVRNPIKAAQIVEIPFVGCLPPCIIESKLLHPLRLQAG
GTVLAANLALKHGWAINVGGGFHHASHSGGGGFCFYADITMAIFDLFDKKAIANAIVVDL
DAHQGNGHARDFADNPNVFVFDVFNPYVYPHDREARQFINRAVHVNGHTTDTSYLSELRK
QLAQCLIDREKTTPPGFDFIMFNAGTDCLLGDPLGAMKLSPQCIIARDEVVFNLAKSKGI
PICMVTSGGYQKDNALLIAKSIENLQSKNLISIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgagataaagatgaaatctttagtttaaaaagttatcaacgtccaattgtc
tatcattctgaatataatgtaactgcatttggaatcgaacatttacatccatttgattct
tcgaaatggagaagagtcattacacatttgaaagaaatgaatctgatcactgatgaaaca
ctcgttgagccaaatctaccgacatttgaagaactcactagagtacatgatagaaaatat
ctgaaaagtgttcgaaatcctattaaagcagcacaaatcgtcgagattccatttgtcggt
tgccttccaccgtgcattattgaaagcaagttattgcatccactacgtttacaagccggt
ggaacagttttagctgccaatttggctctaaaacatggttgggcgatcaacgtgggtggt
ggtttccatcatgcttctcattcgggcggaggtggattctgtttttacgctgatatcacc
atggcaattttcgatttgtttgacaaaaaggcaattgccaacgcgattgttgtagattta
gatgctcatcagggaaatggccatgcacgagactttgctgacaatccgaatgtgtttgta
tttgatgttttcaatccatatgtctatccacatgatcgtgaagctcgtcaatttattaac
agagcggttcatgtaaatggtcatacgactgatacttcctacctctccgaattacgcaaa
caactggcacagtgtttaattgatagagagaaaactactcctcctggtttcgatttcatt
atgttcaacgctggcacagactgtctacttggtgatcctctgggagcaatgaaattgagt
ccacagtgcataattgctcgagacgaagttgtgttcaatctagcaaaatcaaaaggaatt
ccaatttgcatggtaaccagtggagggtatcagaaggacaacgcgcttctcattgcaaaa
tcaattgaaaatctccagtcaaagaatctcatcagtatcaaataa

DBGET integrated database retrieval system