KEGG   Caenorhabditis elegans (nematode): CELE_C35A5.9Help
Entry
CELE_C35A5.9      CDS       T00019                                 

Gene name
hda-11
Definition
Protein HDA-11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(10526286..10526296,10526365..10526589,10526787..10526897,10526944..10527035,10527102..10527214,10527771..10527925,10527974..10528112,10528214..10528372)
Genome map
AA seq 334 aa AA seqDB search
MAERDKDEIFSLKSYQRPIVYHSEYNVTAFGIEHLHPFDSSKWRRVITHLKEMNLITDET
LVEPNLPTFEELTRVHDRKYLKSVRNPIKAAQIVEIPFVGCLPPCIIESKLLHPLRLQAG
GTVLAANLALKHGWAINVGGGFHHASHSGGGGFCFYADITMAIFDLFDKKAIANAIVVDL
DAHQGNGHARDFADNPNVFVFDVFNPYVYPHDREARQFINRAVHVNGHTTDTSYLSELRK
QLAQCLIDREKTTPPGFDFIMFNAGTDCLLGDPLGAMKLSPQCIIARDEVVFNLAKSKGI
PICMVTSGGYQKDNALLIAKSIENLQSKNLISIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgagataaagatgaaatctttagtttaaaaagttatcaacgtccaattgtc
tatcattctgaatataatgtaactgcatttggaatcgaacatttacatccatttgattct
tcgaaatggagaagagtcattacacatttgaaagaaatgaatctgatcactgatgaaaca
ctcgttgagccaaatctaccgacatttgaagaactcactagagtacatgatagaaaatat
ctgaaaagtgttcgaaatcctattaaagcagcacaaatcgtcgagattccatttgtcggt
tgccttccaccgtgcattattgaaagcaagttattgcatccactacgtttacaagccggt
ggaacagttttagctgccaatttggctctaaaacatggttgggcgatcaacgtgggtggt
ggtttccatcatgcttctcattcgggcggaggtggattctgtttttacgctgatatcacc
atggcaattttcgatttgtttgacaaaaaggcaattgccaacgcgattgttgtagattta
gatgctcatcagggaaatggccatgcacgagactttgctgacaatccgaatgtgtttgta
tttgatgttttcaatccatatgtctatccacatgatcgtgaagctcgtcaatttattaac
agagcggttcatgtaaatggtcatacgactgatacttcctacctctccgaattacgcaaa
caactggcacagtgtttaattgatagagagaaaactactcctcctggtttcgatttcatt
atgttcaacgctggcacagactgtctacttggtgatcctctgggagcaatgaaattgagt
ccacagtgcataattgctcgagacgaagttgtgttcaatctagcaaaatcaaaaggaatt
ccaatttgcatggtaaccagtggagggtatcagaaggacaacgcgcttctcattgcaaaa
tcaattgaaaatctccagtcaaagaatctcatcagtatcaaataa

DBGET integrated database retrieval system