KEGG   Caenorhabditis elegans (nematode): CELE_C36A4.9Help
Entry
CELE_C36A4.9      CDS       T00019                                 

Gene name
acs-19
Definition
Protein ACS-19, isoform B
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CELE_C36A4.9 (acs-19)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_C36A4.9 (acs-19)
   00620 Pyruvate metabolism
    CELE_C36A4.9 (acs-19)
   00640 Propanoate metabolism
    CELE_C36A4.9 (acs-19)
Enzymes [BR:cel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CELE_C36A4.9 (acs-19)
Lipid biosynthesis proteins [BR:cel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CELE_C36A4.9 (acs-19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(3864542..3864564,3864608..3865325,3865450..3865565,3865624..3865950,3866002..3866830)
Genome map
AA seq 670 aa AA seqDB search
MEKVSTRIFQIFLPPAPLLAGAHCAGLQSYHDLYRSSINDADEFWRTVSSELHFEQGTSK
GLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYN
ELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESL
AARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKP
DGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTA
GYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTP
SRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLY
KQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVIEGP
GEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDL
MNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINEKLVAEL
KKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIK
QLISGRSARA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtctcgacgaggatatttcagattttcctccctccagccccactccttgcc
ggtgctcactgtgctggccttcaatcttaccacgatttgtaccgttcctcgatcaacgat
gctgacgagttctggcgtaccgtctcatctgaactccatttcgaacaaggaacctctaag
ggtctcgaatggaatttcgactcgaaagctggaaatgtcttcgtcaagtttatggatgga
gccaagactaacatctcgtacaactgtttggaaagaaacattaaacgtggatatggaaac
aaaatcgcctacattttcgaaggaaacgagccaaccgacacctccacctggacatacaac
gagctacacgcccaagtagtccaattctccgctgttctgagatctcatggcgtcaaacga
ggcgatgtggttgctttatatcttccaatgattcccgaattagcagttgcaatgcttgcg
tgtgcccgtatcggagcaatgcattctgttgttttcgctggtttctctgccgaatcactt
gccgctcgtgttgtcgacgctcgctgcagagttttggttacggcggacggagtttttcga
ggagctaaaccaattgggctcaagtcaattgcggatgcagctgccgttctcgcatcgcag
gaagatgtcaaagtggaagctatcattatggtggaacacttaaaacgagtcacgaagcct
gatggagtggaacttcccaaggtcgattacaccgatatcaccgtcatctacgattcggag
atgctcaagtgtgcaggcgtggattccccggtagaatggatggattctgaagatccgcta
tttattctctacacatctggctcaaccggaaaaccgaaaggtattcaacacactacagct
ggatacatgacgtacgcctacgcaaccacaaaatacacttttgatgcacaagaagacgat
gtttactggtgtactgccgattgtggatggatcaccggacactcgtaccttctttatgga
cctttgatgaatgggctcaagggaatttggtatgaaggtgtgccgacttatccgactcct
tctagaatgtgggatgtcactgataagtatggtgtgaccaagctgtatacctcaccaaca
gccgcaagagctcttatggctctcggaaatcagtggcttgaaagctcttctcgcaaaact
ctcaaggttatcggaacagttggagagcccatcaatcctgctgcatggatgtggttgtac
aagcaagttggactttccaatgtatccattgtggatacttactggcaaactgaaactgga
ggacacatgatcacatgccttccaggagcaactccaatgaagccaggagcagctgcaatg
ccattcttcggagcatctccagttcttttggatgctgaaggtcgtgttattgaaggtccg
ggagaaggatcactatgctttgatcgtgcctggcctggaatgatgcgtggaatctatgga
gatgagcaacgctttgtcaagacctatttggctccattcaatggatactatttcactgga
gatggtgccagacgtgatgaagatggatacttgtggataactggacgtgttgatgatttg
atgaatgtcagtggtcatcttctgtctactgctgaaattgaatcagctcttgtggctcat
gagaaagttgctgaagctgccgttgttgctgctccacatgacatcaagggatccttccca
tacgcattcgtcactttgaatgttggagagagaatcaatgaaaagcttgtggctgagctc
aagaaactagttcgcgagaaaattggtgcattggctgttccagatgttatccaagaagct
ccaggacttccaaaaactcgttccggcaaggttaccagaagaatcttgagaaagattgct
gaaggatccgaaagtggaatcggtgatactactactctagtcgacgaatctgtcatcaaa
caactaatctctggacgttctgcacgtgcataa

DBGET integrated database retrieval system