KEGG   Caenorhabditis elegans (nematode): CELE_C36A4.9Help
Entry
CELE_C36A4.9      CDS       T00019                                 

Gene name
acs-19
Definition
Protein ACS-19, isoform A
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cel01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cel00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cel00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cel00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(3864487..3864546,3864597..3865307,3865432..3865547,3865606..3865932,3865984..3866812)
Genome map
AA seq 680 aa AA seqDB search
MSDVRVKFNLANDGEGLDEDIFLPPAPLLAGAHCAGLQSYHDLYRSSINDADEFWRTVSS
ELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNE
PTDTSTWTYNELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSV
VFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIM
VEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTG
KPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIW
YEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEP
INPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLL
DAEGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGY
LWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGE
RINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDT
TTLVDESVIKQLISGRSARA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgttcgcgtcaagttcaacctagccaacgatggagaaggtctcgacgaggat
attttcctccctccagccccactccttgccggtgctcactgtgctggccttcaatcttac
cacgatttgtaccgttcctcgatcaacgatgctgacgagttctggcgtaccgtctcatct
gaactccatttcgaacaaggaacctctaagggtctcgaatggaatttcgactcgaaagct
ggaaatgtcttcgtcaagtttatggatggagccaagactaacatctcgtacaactgtttg
gaaagaaacattaaacgtggatatggaaacaaaatcgcctacattttcgaaggaaacgag
ccaaccgacacctccacctggacatacaacgagctacacgcccaagtagtccaattctcc
gctgttctgagatctcatggcgtcaaacgaggcgatgtggttgctttatatcttccaatg
attcccgaattagcagttgcaatgcttgcgtgtgcccgtatcggagcaatgcattctgtt
gttttcgctggtttctctgccgaatcacttgccgctcgtgttgtcgacgctcgctgcaga
gttttggttacggcggacggagtttttcgaggagctaaaccaattgggctcaagtcaatt
gcggatgcagctgccgttctcgcatcgcaggaagatgtcaaagtggaagctatcattatg
gtggaacacttaaaacgagtcacgaagcctgatggagtggaacttcccaaggtcgattac
accgatatcaccgtcatctacgattcggagatgctcaagtgtgcaggcgtggattccccg
gtagaatggatggattctgaagatccgctatttattctctacacatctggctcaaccgga
aaaccgaaaggtattcaacacactacagctggatacatgacgtacgcctacgcaaccaca
aaatacacttttgatgcacaagaagacgatgtttactggtgtactgccgattgtggatgg
atcaccggacactcgtaccttctttatggacctttgatgaatgggctcaagggaatttgg
tatgaaggtgtgccgacttatccgactccttctagaatgtgggatgtcactgataagtat
ggtgtgaccaagctgtatacctcaccaacagccgcaagagctcttatggctctcggaaat
cagtggcttgaaagctcttctcgcaaaactctcaaggttatcggaacagttggagagccc
atcaatcctgctgcatggatgtggttgtacaagcaagttggactttccaatgtatccatt
gtggatacttactggcaaactgaaactggaggacacatgatcacatgccttccaggagca
actccaatgaagccaggagcagctgcaatgccattcttcggagcatctccagttcttttg
gatgctgaaggtcgtgttattgaaggtccgggagaaggatcactatgctttgatcgtgcc
tggcctggaatgatgcgtggaatctatggagatgagcaacgctttgtcaagacctatttg
gctccattcaatggatactatttcactggagatggtgccagacgtgatgaagatggatac
ttgtggataactggacgtgttgatgatttgatgaatgtcagtggtcatcttctgtctact
gctgaaattgaatcagctcttgtggctcatgagaaagttgctgaagctgccgttgttgct
gctccacatgacatcaagggatccttcccatacgcattcgtcactttgaatgttggagag
agaatcaatgaaaagcttgtggctgagctcaagaaactagttcgcgagaaaattggtgca
ttggctgttccagatgttatccaagaagctccaggacttccaaaaactcgttccggcaag
gttaccagaagaatcttgagaaagattgctgaaggatccgaaagtggaatcggtgatact
actactctagtcgacgaatctgtcatcaaacaactaatctctggacgttctgcacgtgca
taa

DBGET integrated database retrieval system