KEGG   Caenorhabditis elegans (nematode): CELE_C36B1.7Help
Entry
CELE_C36B1.7      CDS       T00019                                 

Gene name
dhfr-1
Definition
Protein DHFR-1
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CELE_C36B1.7 (dhfr-1)
   00670 One carbon pool by folate
    CELE_C36B1.7 (dhfr-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CELE_C36B1.7 (dhfr-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(8736222..8736356,8736401..8736531,8736578..8736730,8736773..8736923)
Genome map
AA seq 189 aa AA seqDB search
MRKMNLIVAMDAEGGIGKNGVLPWRIKKDMQYFASVTKNVSDQSKRNAVLMGRKCWESIP
VTRRPLAGRLNIVLSRQLPAQKSDDYIVVNSLEAAMKLLSEPPFVDSIETIWNIGGAEIY
DLALRENLVDEIHLTRIFKNFEADVHLKSLDFSKMEKVQNAEVSSENSEIFEENGLKFEF
CKWKVVENH
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatgaacttaatagtggctatggatgccgaaggaggaattggcaaaaatggc
gtgttgccatggcgaatcaagaaagacatgcagtatttcgcgtctgttaccaaaaatgtt
tctgatcagtcgaagagaaatgcagttctcatgggacgaaaatgctgggaaagcattcca
gtaactcgccgcccgttggcaggacggctaaacattgttttgagccgacaacttcctgcg
caaaagtccgatgactacattgttgtaaactcgctcgaagcggctatgaaactactttcg
gagccaccatttgtggattcgatcgaaacaatctggaatatcggtggagctgaaatctat
gatcttgcgttgcgagaaaacttggttgatgaaattcacttgacacgtattttcaaaaac
ttcgaagccgatgttcatctcaagtcactcgatttcagtaaaatggagaaagttcaaaat
gccgaggtgtcatcggaaaattcagaaattttcgaagaaaatggattaaagttcgaattt
tgcaaatggaaggttgtcgagaaccactga

DBGET integrated database retrieval system