KEGG   Caenorhabditis elegans (nematode): CELE_C36B1.7Help
Entry
CELE_C36B1.7      CDS       T00019                                 

Gene name
dhfr-1
Definition
Protein DHFR-1
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cel00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cel00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I:join(8736216..8736350,8736395..8736525,8736572..8736724,8736767..8736917)
Genome map
AA seq 189 aa AA seqDB search
MRKMNLIVAMDAEGGIGKNGVLPWRIKKDMQYFASVTKNVSDQSKRNAVLMGRKCWESIP
VTRRPLAGRLNIVLSRQLPAQKSDDYIVVNSLEAAMKLLSEPPFVDSIETIWNIGGAEIY
DLALRENLVDEIHLTRIFKNFEADVHLKSLDFSKMEKVQNAEVSSENSEIFEENGLKFEF
CKWKVVENH
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatgaacttaatagtggctatggatgccgaaggaggaattggcaaaaatggc
gtgttgccatggcgaatcaagaaagacatgcagtatttcgcgtctgttaccaaaaatgtt
tctgatcagtcgaagagaaatgcagttctcatgggacgaaaatgctgggaaagcattcca
gtaactcgccgcccgttggcaggacggctaaacattgttttgagccgacaacttcctgcg
caaaagtccgatgactacattgttgtaaactcgctcgaagcggctatgaaactactttcg
gagccaccatttgtggattcgatcgaaacaatctggaatatcggtggagctgaaatctat
gatcttgcgttgcgagaaaacttggttgatgaaattcacttgacacgtattttcaaaaac
ttcgaagccgatgttcatctcaagtcactcgatttcagtaaaatggagaaagttcaaaat
gccgaggtgtcatcggaaaattcagaaattttcgaagaaaatggattaaagttcgaattt
tgcaaatggaaggttgtcgagaaccactga

DBGET integrated database retrieval system