KEGG   Caenorhabditis elegans (nematode): CELE_C37H5.9Help
Entry
CELE_C37H5.9      CDS       T00019                                 

Gene name
nas-9
Definition
Protein NAS-9, isoform C
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CELE_C37H5.9 (nas-9)
Peptidases [BR:cel01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CELE_C37H5.9 (nas-9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(4836037..4836408,4837456..4837542,4837726..4837795,4837841..4837970,4838027..4838252,4838300..4838425,4838587..4838773,4839324..4839505,4839601..4839639))
Genome map
AA seq 472 aa AA seqDB search
MGLNDADVIGDLRGISRGPRPSSMEWGRRARHFCRRYPGHPKCQRGQLPQFTDVPTIINT
IIYNAGDLLPRVPTLNIHDPLAGLNSELVGFIKSLQSQFGQLSSQQRNEIHDSCRSFKCD
QQSPQNTQAKQELLTKMLAFDQAVGGKAAPAHDKVNLRFDRTQQVKQALLKRANLSHIIV
PADNGVFDRDVLLTEHQANFLLNELGEAGRGADVGAGGGGGGRVPRSGVFFQESAVQKWD
IWKPIQYTLDDSLEESDKKDIRDALHEISINTCILFRYNATPKGYHLNYMKVDSTTFCGL
SYVGRTDPANPIYLSFQCGDNRGVAMHETMHALGVSHQHLRLDRDKYIKIDWSNIDPQHY
DTFAISDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLT
RGDIRLLKKMYCRPGCDDQNVHCGTWALHGYCKMKEQMKWMNENCKASCDKC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggtctaaacgatgctgatgttattggagatttaagaggaatctctcgaggaccccga
ccatcatccatggagtggggacggcgagcccggcatttctgcaggagatatccgggtcat
ccaaaatgtcagcgaggacaacttccacagtttactgatgttccgactattatcaacact
attatctacaacgcgggagatcttcttccacgagttcctaccctaaacatccatgacccg
ttggctggactaaacagcgaactggttggattcatcaagagtcttcagtcacaatttgga
caactcagttcccaacagagaaacgagattcacgattcatgcagatcattcaagtgcgat
cagcagtctcctcagaacacacaggcaaagcaggagctattgacaaagatgctcgccttc
gatcaagcggttggcggtaaagctgctccggctcatgacaaggtgaacctccgattcgac
agaactcagcaagtgaaacaggcattgctcaaaagagcaaatttgtcgcatattatcgtt
ccagctgacaatggagtcttcgacagagatgtgttgctcaccgagcatcaggctaacttc
ctgctcaatgagctcggcgaggccgggcgtggagcagatgttggagcaggaggaggtggt
ggtggacgagttccaagatccggagttttcttccaagaaagtgcggttcagaaatgggat
atttggaagcctattcagtatactttggatgattcattagaagaatccgacaaaaaagac
atccgggatgctctacacgaaatttcaatcaacacctgcatcctattcaggtacaatgca
acgccaaaaggatatcacttgaattatatgaaagttgatagcacgaccttctgcggtcta
tcctacgtgggacggaccgatccggccaacccgatttacttgagcttccagtgtggggat
aatcgaggagttgcaatgcacgaaacaatgcacgcgttgggcgtcagtcaccaacacttg
agactcgacagggataagtatatcaagatcgactggtcaaacatcgacccccaacactat
gacacatttgcgatatccgacgcgaaactgtacacatcctacggtaccaagtacgcctac
gactctataatgcactataacgcatatctcggcgccaaggaccccaacaagccgacgatg
atcccgttggtgaatccacaggagaacaccccgaaactgggtcaacgagccaaactgacc
cgcggcgacatccggttgctcaaaaaaatgtactgccgtccgggatgtgacgatcagaat
gtgcactgcggcacgtgggctctgcatggctattgcaagatgaaggaacaaatgaaatgg
atgaatgagaattgtaaagctagttgtgataaatgttga

DBGET integrated database retrieval system