KEGG   Caenorhabditis elegans (nematode): CELE_C37H5.9Help
Entry
CELE_C37H5.9      CDS       T00019                                 

Gene name
nas-9
Definition
Protein NAS-9, isoform A
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cel  Caenorhabditis elegans (nematode)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(4836023..4836394,4837712..4837781,4837827..4837956,4838013..4838238,4838286..4838411,4838573..4838759,4839310..4839491,4839587..4839780,4839839..4839905))
Genome map
AA seq 517 aa AA seqDB search
MIFLLFVVFPFVYAQLLPELLAGFQNGRFRGGPDGFNRGPGGFHRGPDGFGGDPRGGVDL
GHLIGNIAANVGQEMGLNDADVIGDLRGISRGPRPSSMEWGRRARHFCRRYPGHPKCQRG
QLPQFTDVPTIINTIIYNAGDLLPRVPTLNIHDPLAGLNSELVGFIKSLQSQFGQLSSQQ
RNEIHDSCRSFKCDQQSPQNTQAKQELLTKMLAFDQAVGGKAAPAHDKVNLRFDRTQQVK
QALLKRANLSHIIVPADNGVFDRDVLLTEHQANFLLNELGEAGRGADVGAGGGGGGRVPR
SGVFFQESAVQKWDIWKPIQYTLDDSLEESDKKDIRDALHEISINTCILFRYNATPKGYH
LNYMKVDSTTFCGLSYVGRTDPANPIYLSFQCGDIDWSNIDPQHYDTFAISDAKLYTSYG
TKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLTRGDIRLLKKMYCRPG
CDDQNVHCGTWALHGYCKMKEQMKWMNENCKASCDKC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgatatttctactttttgttgtttttccatttgtatatgcacagcttttgccagagtta
ttagcaggttttcagaatggaaggtttagagggggacccgatggttttaatagaggacct
ggagggtttcatcgtggacctgacggcttcgggggagaccctcgtggcggtgtagacctc
ggccacttgattgggaatattgctgcaaatgttggtcaagaaatgggtctaaacgatgct
gatgttattggagatttaagaggaatctctcgaggaccccgaccatcatccatggagtgg
ggacggcgagcccggcatttctgcaggagatatccgggtcatccaaaatgtcagcgagga
caacttccacagtttactgatgttccgactattatcaacactattatctacaacgcggga
gatcttcttccacgagttcctaccctaaacatccatgacccgttggctggactaaacagc
gaactggttggattcatcaagagtcttcagtcacaatttggacaactcagttcccaacag
agaaacgagattcacgattcatgcagatcattcaagtgcgatcagcagtctcctcagaac
acacaggcaaagcaggagctattgacaaagatgctcgccttcgatcaagcggttggcggt
aaagctgctccggctcatgacaaggtgaacctccgattcgacagaactcagcaagtgaaa
caggcattgctcaaaagagcaaatttgtcgcatattatcgttccagctgacaatggagtc
ttcgacagagatgtgttgctcaccgagcatcaggctaacttcctgctcaatgagctcggc
gaggccgggcgtggagcagatgttggagcaggaggaggtggtggtggacgagttccaaga
tccggagttttcttccaagaaagtgcggttcagaaatgggatatttggaagcctattcag
tatactttggatgattcattagaagaatccgacaaaaaagacatccgggatgctctacac
gaaatttcaatcaacacctgcatcctattcaggtacaatgcaacgccaaaaggatatcac
ttgaattatatgaaagttgatagcacgaccttctgcggtctatcctacgtgggacggacc
gatccggccaacccgatttacttgagcttccagtgtggggatatcgactggtcaaacatc
gacccccaacactatgacacatttgcgatatccgacgcgaaactgtacacatcctacggt
accaagtacgcctacgactctataatgcactataacgcatatctcggcgccaaggacccc
aacaagccgacgatgatcccgttggtgaatccacaggagaacaccccgaaactgggtcaa
cgagccaaactgacccgcggcgacatccggttgctcaaaaaaatgtactgccgtccggga
tgtgacgatcagaatgtgcactgcggcacgtgggctctgcatggctattgcaagatgaag
gaacaaatgaaatggatgaatgagaattgtaaagctagttgtgataaatgttga

DBGET integrated database retrieval system