KEGG   Caenorhabditis elegans (nematode): CELE_C38H2.2Help
Entry
CELE_C38H2.2      CDS       T00019                                 

Gene name
C38H2.2
Definition
Protein C38H2.2
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    CELE_C38H2.2 (C38H2.2)
Enzymes [BR:cel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     CELE_C38H2.2 (C38H2.2)
Glycosyltransferases [BR:cel01003]
 Glycan extension
  Type 3 chain
   CELE_C38H2.2 (C38H2.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III:join(10381692..10381784,10381902..10381997,10382243..10382454,10382798..10383112,10383162..10383299,10383928..10384040,10384207..10384287,10384545..10384666)
Genome map
AA seq 389 aa AA seqDB search
MANWPRVSPLAYVALGVLLGLTISIISQTGTTTYDAASRIAILRANRGDPQVDEHDHAHG
NDPHGDEEVDDHHANFAPVQFHSNNSSHSHDGESLIADEVAKKVRVFCWILTGKQNHDKR
AKHVKATWAKRCNKYVFMSSEEDAELPAINLNVSEGRDYLWAKTKGAFKYIYDHHLNDYD
WFLKADDDTYVVMENLRFMLLAHSPDEPIHFGCKFKPFTQGGYHSGGAGYVLSREALKKF
IEVALPDKSLCSQNHGGAEDAEMGKCLEKVGVKAGDSRDADGHHRFMPFVPEHHLSPGHV
DPKFWFWQYTYYPMDQGPTCCSDYAVSFHYVNPNLMYVLEYLIYHLKPFGIDRAIRVPKN
ETIIHTAYSISRSERGQDDAFRDRPEVAV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactggccacgtgtttctcctctcgcctacgtggcgcttggcgttcttctcggt
ttgaccatttcaataatatctcagacgggaacgacaacctacgacgctgcctcacggata
gccatactacgagccaaccgaggggatccacaagttgacgagcacgatcatgcacatgga
aatgatccgcacggagacgaagaagtcgacgatcatcacgcgaactttgcgcccgtccaa
ttccattccaacaactcatcgcatagccatgatggtgaaagtctgatagccgacgaagtt
gcgaagaaggttcgcgtcttctgttggattctcaccggaaaacagaatcacgataaacgc
gcgaaacacgtcaaagccacctgggccaagcggtgtaataagtacgtattcatgtcatca
gaagaggatgcagaactcccagccatcaacctaaatgtctctgaaggcagagattacttg
tgggcaaaaacaaaaggagcattcaaatacatttatgaccatcacctgaacgactacgac
tggttcctgaaagccgacgacgatacctatgtggtgatggaaaatctccggttcatgcta
ttggctcattcaccggatgagccaattcactttggatgcaagtttaagccattcacacag
ggaggatatcatagtggtggagctggatatgtgctcagtcgggaggcactgaaaaaattc
attgaagtagcgctgccggacaaatcgttgtgctctcagaatcatggtggagccgaggat
gcggagatgggcaaatgcttggagaaggttggagtgaaagctggagattccagagatgcc
gatggacatcatagattcatgcctttcgtgccggaacatcacttgtcgcctggccacgtt
gaccccaagttctggttctggcagtacacttactacccaatggatcaaggacctacgtgt
tgctctgattacgcagtctccttccactacgtcaacccgaacttgatgtatgtgctcgag
tatctcatctatcacttgaagcctttcggtatcgatcgcgcgattcgagtgccaaagaac
gaaacaataatccatacggcttattcgatctctcgatccgaacgtggacaagacgatgcg
ttccgggatcggccggaagttgctgtataa

DBGET integrated database retrieval system