KEGG   Caenorhabditis elegans (nematode): CELE_C42C1.14Help
Entry
CELE_C42C1.14     CDS       T00019                                 

Gene name
rpl-34
Definition
(RefSeq) Ribosomal Protein, Large subunit
  KO
K02915  
large subunit ribosomal protein L34e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CELE_C42C1.14 (rpl-34)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CELE_C42C1.14 (rpl-34)
  Archaea
    CELE_C42C1.14 (rpl-34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
Ensembl: 
UniProt: 
Position
IV:join(12269002..12269160,12269288..12269461)
Genome map
AA seq 110 aa AA seqDB search
MSLRVTYRRRLSYNTTSNKKRLVKTPGGRLVVQYIKKRGQIPKCRDTGVKLHGITPARPI
ALRLLKRNERTVTRAYGGCLSPNAVKERITRAFLVEEQKIVNKVIKHQKD
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccgcgttacctacagacgccgtttgtcgtacaacaccacctccaacaagaag
cgtcttgtcaagaccccaggaggacgtctcgttgtccaatacatcaagaagagaggacaa
attccaaagtgcagagacaccggagtcaagctccacggaatcaccccagctcgcccaatc
gctctccgccttctcaagagaaacgagcgtaccgtcaccagagcctacggaggatgcctc
tcaccaaacgccgttaaggagcgcattacccgtgctttcctcgtcgaggagcagaagatc
gtcaacaaggtcatcaagcaccagaaggactaa

DBGET integrated database retrieval system