KEGG   Caenorhabditis elegans (nematode): CELE_C49C8.4Help
Entry
CELE_C49C8.4      CDS       T00019                                 

Gene name
cyp-33E1
Definition
Protein CYP-33E1
Orthology
K17955  
cytochrome P450, family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_C49C8.4 (cyp-33E1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV:complement(join(8645582..8645857,8645903..8646040,8646631..8646841,8646887..8647049,8647173..8647308,8647353..8647484,8647533..8647645,8647711..8647859,8647968..8648052,8648099..8648180))
Genome map
AA seq 494 aa AA seqDB search
MILLILTSILIIYLFNHFYWKRRKLPPGPIPLPIIGNLYLMTEDVKPGYKMYEKLKDKYG
PVFTFWLANLPMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMRQGPYGIIESHGDRWI
QQRRFALHILRDFGLGKNLMEEKVLGEVTAMIDSIRKSMEDVDMQNIFDASVGSVINNML
FGYRYDETNIEEFLELKNRMNKHFKLAAEPMGGLIGMNPWLGHLPFFKGYKNVIMHNWMG
LMEMFRKQATDRLASIDYDSDEYSDYVEAFLKERKKHENEQDFGGFEMEQLDSVCFDLWV
AGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIITTTDRPKLNYINATVNESQ
RLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLESD
GSLKKVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKFHESNPNPSIKKEVGVT
MKAKNYRVSMKERY
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgattttacttattctcacttcgatattaattatctacctctttaatcatttttactgg
aagagaagaaaattaccaccaggtccaattccactccctattattggaaatttatatctt
atgacggaagatgttaagccaggatacaagatgtacgagaaattgaaagacaaatatggt
ccagtgttcacattttggttggcaaatcttccaatggttactgtgactgattggaaactc
atcaagcagcatttcataaaagatggagccaactttgtaggaagaccagagtttccaatt
tcaatggaaatgagacaaggtccatatggaattattgaatctcatggtgatagatggatt
cagcaaagaagatttgcattgcatattcttcgagattttggattgggaaagaatttgatg
gaagaaaaggttcttggtgaagttactgcaatgattgacagtattcgaaaaagcatggaa
gatgttgatatgcaaaatatatttgatgcatccgtgggatccgtaatcaataatatgctt
tttggatatcgttatgatgagacaaacattgaagaatttctggaactcaaaaatcgaatg
aataagcatttcaagttagctgcagaaccaatgggaggacttattggaatgaatccatgg
cttggacatctcccgtttttcaagggatataaaaatgtaataatgcacaactggatgggt
ctcatggaaatgttccgtaagcaggctacagatagacttgcatcaattgactatgattct
gatgaatattcggattacgtagaagcatttttgaaagaaagaaagaaacatgaaaatgag
caagatttcggaggatttgaaatggaacaacttgatagtgtatgttttgatctatgggtt
gctggaatggaaacaacttcaaatactctcaattgggcacttctctatgtccttttgaat
ccagaagtacgtcaaaaagtctatgaagaattggaaagagaaattggaagtgataggatt
attacaactaccgaccgacctaaactcaactatatcaatgcaactgttaatgaatctcaa
cgtcttgctaatcttcttccaatgaatctatctagatctacaaatgctgatgttgaaatt
gctggctaccgtattccaaaagatactgtaatcactccacaaatcagttcagtaatgtat
gatccagagatattccctgaaccatacgaattcaaacctgaaagattcctagaatcggat
ggaagtttgaaaaaagtagaagaacttgtgccattttcaattggaaaacggcaatgtctt
ggagaaggactggccaaaatggaactattcttgtattttgcaaatttgttcaacaaattt
gatattaaatttcacgaatcgaatccaaatccaagtattaaaaaggaagtcggagttact
atgaaggcaaagaattacagagtttcaatgaaggaaagatattga

DBGET integrated database retrieval system