KEGG   Caenorhabditis elegans (nematode): CELE_C51E3.7Help
Entry
CELE_C51E3.7      CDS       T00019                                 

Gene name
egl-3
Definition
Protein EGL-3, isoform C
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     CELE_C51E3.7 (egl-3)
Peptidases [BR:cel01002]
 Serine Peptidases
  Family S8: subtilisin family
   CELE_C51E3.7 (egl-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(10169781..10169930,10170150..10170444,10170510..10170968,10171021..10171511,10171917..10172009,10172060..10172113,10172624..10172665))
Genome map
AA seq 527 aa AA seqDB search
MSPSDPLYGYQWYLKNTGQAGGKARLDLNVERAWAMGFTGKNITTAIMDDGVDYMHPDIK
NNFNAEASYDFSSNDPFPYPRYTDDWFNSHGTRCAGEIVAARDNGVCGVGVAYDGKVAGI
RMLDQPYMTDLIEANSMGHEPSKIHIYSASWGPTDDGKTVDGPRNATMRAIVRGVNEGRN
GLGSIFVWASGDGGEDDDCNCDGYAASMWTISINSAINNGENAHYDESCSSTLASTFSNG
GRNPETGVATTDLYGRCTRSHSGTSAAAPEAAGVFALALEANPSLTWRDLQHLTVLTSSR
NSLFDGRCRDFPSLGINDNHRDSHGNCSHFEWQMNGVGLEYNHLFGFGVLDAAEMVMLAM
AWKTSPPRYHCTAGLIDTPHEIPADGNLILEINTDGCAGSQFEVRYLEHVQAVVSFNSTR
RGDTTLYLISPMGTRTMILSRRPKDDDSKDGFTNWPFMTTHTWGENPTGKWRLVARFQGP
GAHAGTLKKFELMLHGTREAPYNLIEPIVGQTNKKLDTVQKAHKRSH
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatcggatccactttatggatatcagtggtacttgaaaaacactggacaagct
ggcggaaaagctcgtttggatttgaatgtggaaagggcttgggcaatgggatttactgga
aagaacatcacaacagcgattatggatgacggagtggattacatgcatccggatattaag
aacaactttaatgccgaagcttcatacgatttctcatcaaatgatccattcccatatcca
agatacactgatgactggttcaattcccacggaactcgatgcgccggagaaatcgttgcc
gcccgtgacaacggtgtctgtggagtcggagttgcctatgacggaaaggttgctggaatc
agaatgcttgatcaaccctacatgaccgatctcattgaagccaattcaatgggacacgag
ccgagcaaaattcatatctactctgcttcatggggaccgactgatgatggaaagactgtt
gatggaccacgtaatgccactatgcgagcaatcgtcaggggtgtcaacgagggacgtaac
ggacttggatccatttttgtttgggccagtggagacggaggagaggatgatgattgtaat
tgtgatggatatgcggcaagcatgtggacaatctcgatcaattcagccattaacaatgga
gaaaatgctcactacgatgaatcttgttcatcaacccttgcttccactttctccaatgga
ggacgaaacccagaaaccggagtcgctactaccgatctctacggaagatgcacccgatct
cactccggaacttccgctgctgctccagaagcggcaggagtctttgcccttgctcttgaa
gccaatccatctcttacctggagagatctccaacacttgacagttctcacttcaagcaga
aactccctgtttgacggaagatgccgtgacttcccatctctcggaatcaacgataaccac
cgcgactctcatggaaactgttctcactttgaatggcaaatgaatggagttggactcgag
tacaatcaccttttcggatttggagttcttgatgcagcagagatggtcatgttggcaatg
gcctggaagacttccccaccacgttatcactgtactgctggactcattgacactccacat
gagatcccagccgatggaaacttgattcttgaaattaatactgatggatgtgccggatct
caattcgaagtccgctacctggaacatgttcaagcagttgtctcgttcaactcgactcgt
cgtggagataccactctctacttgatctctccaatgggaacccgtaccatgattctttcc
cgcagaccaaaggatgatgattcaaaggatggattcaccaactggccattcatgacaaca
cacacatggggagagaatccaacaggaaaatggagacttgtcgccagattccaaggacct
ggagctcatgccggaacccttaagaagttcgagctgatgttgcacggaacaagagaagcc
ccatacaatctcatcgagccaatcgtcggtcaaaccaacaagaagctcgacaccgttcaa
aaagcccacaaacgcagccactaa

DBGET integrated database retrieval system