KEGG   Caenorhabditis elegans (nematode): CELE_C52A10.2Help
Entry
CELE_C52A10.2     CDS       T00019                                 

Gene name
C52A10.2
Definition
Protein C52A10.2
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CELE_C52A10.2 (C52A10.2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CELE_C52A10.2 (C52A10.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:complement(join(5234845..5235037,5235235..5235500,5235640..5235803,5235854..5236063,5236124..5236246,5236289..5236622,5236668..5236757,5236796..5236957,5237019..5237111))
Genome map
AA seq 544 aa AA seqDB search
MGGFLSHLKPEKNTEVFNASCGPIRGNVYEHGDKIVNGYLGIPFAKAPIGDLRFKKSVEA
EKWTQPLDCYKYGPGCPQSAALGALMVSQATNHDFAEDNCLNLNVFAPKWKSAEFPNGFP
VMVYFYGGGFEVGFSSMFDDYSLTGTLPLKDVILVTPNYRIGPLGFFATGDDVARGNWGL
WDQALALQWVQKHIKSFGGDPSNVTISGTSAGGASVDFLSLSPHANKYFQKFIPMSGAAT
CPFGIRSKDVEGLIFREFANHHGYTGNDSKSLLQWYQSQDSEIFLKAEGYKCPASGMFSF
VPNFDGDFFPKPFDELRKEAPKLGAIVSIGEYEGLGFEDFYAGQKTPQQMLSAALGPEVV
RNREEVVKRAAESYLKNGGNENEENIAKTLVEIFGDYYFSVGAFDTVRSLVKYGNTVYLY
SFNYFNPNTPIVFGKNRPFNAANHGSDLRYIFGEGTGEFSKEDRQVMDMMGTYHTNFAKY
GNPNGKGVSVPWEKYSLDNPGRYFKIDYPKCEMADNFLDGRHKIIDEVNEHGIQYQEMVF
GKKI
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggtggattcctttcacacttgaaacctgaaaaaaataccgaagttttcaatgcttca
tgtggtccgattcgtggaaatgtttacgaacatggggacaaaatcgtgaatggatatctc
ggaattccatttgccaaggctccaatcggagaccttcgattcaaaaaatcagtcgaagct
gagaaatggacgcaaccactggattgctataaatacggaccgggatgtccacagtcagca
gcccttggagccttgatggtttcacaagctactaatcatgatttcgctgaagataattgc
ttgaacctcaacgtgtttgcaccaaaatggaaatctgccgaattcccaaacggttttcct
gtaatggtttacttctatggtggaggtttcgaggttggattctcatcgatgtttgatgat
tattctttaactggaactcttccacttaaagatgtaattctagtcactcccaactaccga
attggacctctcggatttttcgctactggagatgacgtggcacggggaaactggggacta
tgggatcaagctttggctctacagtgggtacaaaagcatattaaatcatttggaggagat
ccaagcaatgtgactatttctgggacaagtgccggtggagcaagtgttgattttctgtcc
ctgagtccacatgctaataaatatttccaaaagttcattcctatgtctggtgcggcgaca
tgtccatttggtatccgttcgaaagatgttgagggattaattttccgagagtttgccaac
catcatggctacaccggcaatgattcgaaaagcctgctgcaatggtatcaatcccaggac
tctgagatattcctcaaagcggaaggatacaagtgtccagcttctggcatgttttccttt
gttccaaacttcgacggagatttcttcccaaaaccatttgacgagttgagaaaagaggcg
ccgaaacttggtgccatcgtttcaattggtgaatatgaaggacttggttttgaagacttc
tatgctggccagaaaacccctcaacaaatgctatcagcagctttgggtcctgaagttgta
aggaacagggaagaggttgtcaagagagctgcagaatcttatttgaaaaatggtggaaac
gaaaatgaagaaaacattgccaagacattagttgagatatttggagactactacttcagt
gtgggagcatttgatactgttcgatcacttgtcaagtatggaaatactgtatatttgtat
tctttcaattatttcaatccgaacactccaattgtgtttggcaaaaacaggccgttcaat
gcagctaatcatggttctgatttaagatatatttttggagaagggactggagagttttcg
aaagaagataggcaggttatggatatgatgggaacttatcatacaaattttgcaaaatat
ggaaatccaaatgggaaaggtgtatcggttccatgggaaaagtacagtcttgacaatccg
ggaagatatttcaagattgattatccaaaatgtgaaatggctgacaatttcttggatgga
aggcacaagattatagatgaagttaatgaacacggaatacaatatcaagaaatggttttt
ggaaagaaaatataa

DBGET integrated database retrieval system