KEGG   Caenorhabditis elegans (nematode): CELE_C52B9.1Help
Entry
CELE_C52B9.1      CDS       T00019                                 

Gene name
cka-2
Definition
(RefSeq) CKA-2, isoform A
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_C52B9.1 (cka-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CELE_C52B9.1 (cka-2)
    2.7.1.82  ethanolamine kinase
     CELE_C52B9.1 (cka-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
X:join(4286979..4286992,4287573..4287650,4289485..4289637,4289685..4289904,4289951..4290084,4290131..4290460,4290504..4290609,4291061..4291240,4291287..4291361)
Genome map
AA seq 429 aa AA seqDB search
MSSRKVSRAHYDEDELASAANMSLVAEGHFRGMKELLSTMDLDTDANTIPELKERAHMLC
ARFLGGAWKTVPLEHLRISRIKGGMSNMLFLCRLSEVYPPIRNEPNKVLLRVYFNPETES
HLVAESVIFTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLAHMSTKIAKRVAKV
HQLEVPIWKEPDYLCEALQRWLKQLTGTVDAEHRFDLPEECGVSSVNCLDLARELEFLRA
HISLSKSPVTFCHNDLQEGNILLPKASSGNIRMPSLSDETQALGNSLSAFNPADPRLVLI
DFEYASYNYRAFDFANHFIEWTIDYDIDEAPFYKIQTENFPENDQMLEFFLNYLREQGNT
RENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSPVGFGFADYGRDRLSLYFKHKQ
LLKNLASHQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagaaaagtttcccgtgctcactacgacgaggacgaactcgcgtcggctgca
aacatgagtctcgttgctgaaggacatttcagaggcatgaaggagcttctctccaccatg
gatcttgacacggatgccaacaccatccctgagttgaaagagagagctcacatgctatgc
gcaagattccttggcggagcatggaaaactgttccattggagcatttgagaatcagtcgc
atcaagggtggaatgagcaacatgttattcttatgccgactttcggaagtctatccacca
attcgtaacgaaccaaacaaggttctgcttcgtgtctacttcaatccagagactgagagt
catctcgttgcggaatctgtcattttcactctgctctctgagcgtcatttgggtcccaag
ctttatggaattttcagtggtggacgtctagaagagtatataccttctcgcccactctct
tgccatgaaatttcattagcacacatgtctacaaaaattgcaaagcgcgttgcgaaggtt
catcaattggaagtaccaatttggaaagaacccgattatctgtgtgaagctctgcagagg
tggctgaaacaactaactggaactgtcgatgcggaacatcgtttcgaccttcctgaagag
tgtggagtttccagtgtcaattgtctagacttagcaagggagttggagtttctgagagct
catatctcactgagcaaaagccctgtaacattttgtcacaatgacttacaagaaggcaat
attttacttccaaaagcttcttccggtaacattcgtatgccttcgctatcggatgagact
caagcgttgggtaacagcttatcagcattcaacccagctgatcctcgtcttgtgctcatt
gattttgagtatgctagctacaactacagagcattcgattttgccaatcacttcatcgaa
tggactattgactacgacattgacgaagctccattctacaaaattcaaaccgagaacttc
cccgaaaatgatcaaatgctcgaattcttcttgaactatcttcgcgaacaaggcaatacc
agagaaaacgaactctacaagaaatccgaagatcttgtccaagaaactcttccgtttgtt
ccagtctctcatttcttttggggtgtgtggggactgttgcaagtcgaactttccccagtt
ggattcggatttgcggactacgggagagatcgtctgtcgctgtacttcaaacataaacaa
cttctcaaaaaccttgcaagtcatcaataa

DBGET integrated database retrieval system