KEGG   Caenorhabditis elegans (nematode): CELE_C53A5.3Help
Entry
CELE_C53A5.3      CDS       T00019                                 

Gene name
hda-1
Definition
Protein HDA-1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:cel04330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(14525393..14525566,14525613..14525730,14525776..14526642,14526736..14526962)
Genome map
AA seq 461 aa AA seqDB search
MNSNGPLMEHGKRRVAYYYDSNIGNYYYGQGHVMKPHRIRMTHHLVLNYGLYRNLEIFRP
FPASFEDMTRFHSDEYMTFLKSANPDNLKSFNKQMLKFNVGEDCPLFDGLYEFCQLSSGG
SLAAATKLNKQKVDIAINWMGGLHHAKKSEASGFCYTNDIVLGILELLKYHKRVLYVDID
VHHGDGVEEAFYTTDRVMTVSFHKYGDFFPGTGDLKDIGAGKGKLYSVNVPLRDGITDVS
YQSIFKPIMTKVMERFDPCAVVLQCGADSLNGDRLGPFNLTLKGHGECARFFRSYNVPLM
MVGGGGYTPRNVARCWTYETSIAVDKEVPNELPYNDYFEYFGPNYRLHIESSNAANENSS
DMLAKLQTDVIANLEQLTFVPSVQMRPIPEDALSALNDDSLIADQANPDKRLPPQITDGM
IQDDGDFYDGEREGDDRRNESDAKRAAQFESEGGEKRQKTE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaacggcccgttgatggagcacggtaagcgccgtgtcgcctactactatgac
tccaacattggaaattactattatggtcaagggcacgtcatgaagccacatcgtatcaga
atgacccatcatctcgttctcaactatggtctgtaccggaatttagagattttccgccca
ttccctgcatcattcgaagacatgactcgttttcacagcgacgagtacatgacgtttttg
aagagtgcgaatccagataatctgaaatccttcaacaaacaaatgcttaagttcaatgtt
ggagaagattgtcctctctttgatggtctttatgagttctgccaactcagttcgggaggt
tctctggctgctgccactaaattgaacaagcagaaggtggacattgctatcaattggatg
ggaggcctccatcacgccaagaaaagcgaggcgtccggattctgttacaccaatgacatc
gttctcggtattctcgagcttctcaagtaccacaagcgagtactttacgtcgatattgat
gttcatcacggagatggagtagaggaggcgttctatacgactgatcgagtaatgacagtg
tcattccataaatatggagatttcttcccaggaaccggagacctgaaagatataggagct
ggaaaaggaaagctctattcagtcaatgttccacttcgcgatggaatcaccgacgtctct
taccagagtatttttaaaccaatcatgacaaaggttatggagagatttgatccctgtgct
gttgttcttcaatgtggagctgattctctcaacggagatagacttggaccattcaatctg
accttgaaaggccacggagaatgtgctcgtttcttccgaagctacaacgttccacttatg
atggtcggtggaggtggatacactccaagaaatgtggcacgttgttggacgtacgaaacc
tcgattgccgtcgataaggaagttccaaatgagttgccatacaatgactacttcgaatac
tttggaccaaactaccgacttcacatcgagtcgtcgaatgcagcaaatgaaaatagctcc
gatatgctggctaaattgcaaactgacgtcatcgccaatctcgagcagctcacttttgtt
ccaagtgttcaaatgagaccgatcccagaagacgccctctctgcattgaatgatgactca
ttgatcgccgaccaagctaatcccgacaaacgactaccaccacaaattaccgatggaatg
attcaagacgatggagacttctacgatggtgagcgtgagggagatgatcgaagaaacgag
agcgatgcgaagagagcagctcagtttgagtcggaaggtggtgaaaagcgtcagaagaca
gagtaa

DBGET integrated database retrieval system