KEGG   Caenorhabditis elegans (nematode): CELE_C54D1.3Help
Entry
CELE_C54D1.3      CDS       T00019                                 

Gene name
ist-1
Definition
Protein IST-1
Orthology
K16172  
insulin receptor substrate 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CELE_C54D1.3 (ist-1)
   04150 mTOR signaling pathway
    CELE_C54D1.3 (ist-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(7132207..7132336,7132891..7133123,7133536..7133673,7133732..7133906,7133949..7134072,7134127..7134244,7134302..7134489,7134541..7134552,7135779..7136000,7136051..7136189,7136240..7136440,7136880..7137124,7137174..7137335,7137385..7137866,7138777..7138921,7138973..7139270)
Genome map
AA seq 1003 aa AA seqDB search
MLPAEPTSGEPKNDGEYVETMFDATEEKKQETIAPKQEETVKKLSMAAREERIRESRQQG
QLKEKRLKNPDSKGDTSHDKPTRETWKPLAVEDLPKDEDPDEFGIPEVYKCGNCLVGFAP
VKKKKLMFVTLTERCLELHESEKSYRAGKAAKHMVDLSMSFNVHSEHYDAKLKKCLCLMG
PDETICMRPEGGILTIEGWRRAIVKLIHESRRRKMDRVPRPEDIFDAAYDVRVCLFPKNL
EKYVESLKTDGFTNICTVAKELLGKKRLCLYPNTLAIVDLCIEPTAYGLPPAGFPPFRAS
SMFILERNTVAYYGFRENYFYVRIGKGSPYRGFELLFQVDTNEVCKEIYSRLRALADRDL
ENRKQESIRRPERPRVSTLQSVKPGKEETGLREALLESYGHLRKKNSTQSERGEIVVPEQ
ERKMSDNRPRLRTQDIKTVTKPELKSEEPIRPRLPPLKFNANKPSGEFLLSLQREKELME
EARKNGYDGRTHNPDGTPREIKKDFLDTVCPQAAAPEVVIKEKIINNDTYTLMGPADWGK
LEDIVKDDYSDSGDSCYSSRRGTGSQPTRPAASHLACQMQNRTQSFGAKQQTFQNRLPPT
VNLPDSERKISAANQGTSNQLDLPQEDPRKRAFSLGSKNFFNLIGLNDFRRLVSKRHRTS
SPNHTSTSGISLNSSNASPSASSNFLASSEYLEHARTDSFGSARSSPKSLHTQRTSSPKR
RSDEDLISIDFSRLGKNSASDTKRFPFGGGGPGGSFDYDREKREKEDNNRRDREKAAMDL
KRKEEWEARELAEKKRELERKIQAKKDRKLEKGRGKDREKDKDHDHDKEFRPKADSGIAD
CTPSSSFSGKKDHKNDGSSDSAYMDKEGLKYLADIKKRKKEQGAIDTTNSSSSSLSTIVS
IEDNKVTRRITETVETKVVTADLAKALGAIDPNRRSSACIEINRKPSICTAIMEEREGEA
SETDSRGEPSDRKTTAAPVTRKPASTGSSMSPFRRLKFLSFRK
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccgccgagcctacatctggtgaaccgaaaaatgacggagagtacgttgagaca
atgtttgacgccacggaagagaagaaacaagaaacgattgcgccaaaacaggaagaaact
gtaaagaaattatcaatggcagcaagagaggagagaatacgcgaaagtagacaacaaggg
caactgaaagaaaaaaggctgaaaaatccagattcaaaaggtgatacaagtcacgataag
ccgaccagagaaacatggaagccgttagccgttgaagacttaccaaaggatgaagatccg
gatgaatttggaattccagaagtctacaaatgtggaaattgtttagtagggtttgctcca
gtgaaaaagaaaaagctaatgtttgtgacactcacggaacgatgtttagaacttcacgag
tcggagaaatcctatcgtgcgggaaaagcagcaaagcatatggtagatctctcaatgtct
tttaatgtgcacagtgagcattacgatgcaaaactaaagaaatgcctatgcttgatgggt
ccagacgaaacaatatgcatgagaccggaaggaggaattctaaccattgaaggttggcga
cgagcaattgtaaaactaattcatgaatcaagaagaagaaaaatggaccgcgttccgaga
cctgaagatatttttgatgctgcatatgatgtacgtgtttgtctatttccaaaaaacttg
gaaaaatacgtggaaagcttgaaaacagacgggttcacaaacatatgtactgttgccaaa
gagcttttaggaaagaaaagattatgcctttatccaaatacacttgccattgttgatctc
tgcattgaaccaactgcctatggtctcccacctgccgggtttcccccattccgtgcatca
agcatgttcattttggagcgaaatacggttgcttactacggttttcgtgaaaactatttc
tatgtacgaattggaaagggaagcccctatcgagggtttgagttattgttccaagtggac
actaacgaagtttgtaaggaaatttactcacgtcttagagcactcgctgatcgtgatctt
gaaaaccggaaacaagaatctatacggagaccagaaagaccccgtgtttctactcttcaa
agtgtgaaaccgggcaaagaagaaaccggactacgtgaagcacttcttgaatcatatggc
catttaagaaaaaagaattcaacacaatcagagcgaggagagatagttgttccggagcaa
gaacggaaaatgtcagacaacaggcctcggctcagaactcaggatataaaaactgttaca
aagcctgaactgaaatcagaagaacctatacgcccgagacttccaccgctaaaattcaat
gctaacaaaccgtctggagaatttttattatcgctccaacgggagaaagagttaatggaa
gaggcaagaaaaaatggttatgatggaagaacacacaatcctgatgggactcctcgagaa
atcaaaaaagatttcctcgacactgtttgtccacaagctgcagcgccagaagttgtgatc
aaagagaaaatcataaacaacgatacttatacgctgatgggtccagccgactggggaaaa
ctggaagatattgtcaaagatgattactcggacagtggggacagttgttattcatcaaga
agaggaaccggtagtcaaccgacccgaccggccgcttctcacctcgcatgtcaaatgcaa
aaccgaacacagtcatttggagctaaacaacaaacatttcaaaaccgacttccgcctact
gtaaatctgcctgattctgaaagaaaaatttcggctgccaaccaaggaacgtcaaaccaa
ctcgaccttccacaagaagatccaagaaaaagagcattctcattgggaagtaaaaacttt
ttcaacctgataggattgaatgactttcgtcgccttgtaagcaagcgtcatcgaacatca
tctccaaaccacacctctacttctggtatctcgttaaactcatctaacgcatccccgtca
gcaagtagtaattttttggcttcttctgaatatttagaacatgcaagaactgatagtttt
gggtccgcaagaagtagtccaaaaagtctacacacccagcgaaccagttcaccgaaaaga
agatcggacgaggatctgatctcaattgacttttcaagattaggtaaaaattctgcatca
gatacaaaacgatttccttttggtggaggaggaccaggagggtcctttgattatgataga
gaaaaacgggaaaaggaagataataatagacgagaccgagaaaaagcagcaatggatttg
aaaagaaaagaagaatgggaagcgagagaattagcggaaaagaagagggagttggaacgg
aaaattcaagcaaagaaagatagaaaattggagaagggaagagggaaagatagagaaaag
gataaagaccacgatcatgataaggagtttcgtccaaaagcggacagtggaattgctgat
tgtacgcccagttcaagtttttctgggaagaaagatcacaaaaatgatggttcttctgat
tctgcatacatggacaaagaagggttgaagtacttggcagatatcaaaaaacggaaaaaa
gagcaaggtgccatagacacaacaaattcctcctcctcctcgttaagcacaatagtttcg
attgaagataacaaagtgaccagaagaatcacggaaaccgttgaaacaaaagttgtgact
gcggatctagcgaaagcacttggtgcaattgacccgaatagaagatcttcagcatgcatt
gagataaatcgaaaaccatcgatttgtacagcaataatggaagaaagagaaggagaagca
tctgagaccgattctaggggagaaccatccgacaggaagacgaccgcggcccctgtaact
cggaaacctgcatcgactggcagcagcatgagcccgttcagaagacttaaatttctcagc
ttcagaaaataa

DBGET integrated database retrieval system