KEGG   Caenorhabditis elegans (nematode): CELE_C54D1.3Help
Entry
CELE_C54D1.3      CDS       T00019                                 

Gene name
ist-1
Definition
Protein IST-1
Orthology
K16172  
insulin receptor substrate 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CELE_C54D1.3 (ist-1)
   04150 mTOR signaling pathway
    CELE_C54D1.3 (ist-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X:join(7132164..7132293,7132848..7133080,7133493..7133630,7133689..7133863,7133906..7134029,7134084..7134201,7134259..7134446,7134498..7134509,7135736..7135957,7136008..7136146,7136197..7136397,7136837..7137081,7137131..7137292,7137342..7137823,7138734..7138878,7138930..7139227)
Genome map
AA seq 1003 aa AA seqDB search
MLPAEPTSGEPKNDGEYVETMFDATEEKKQETIAPKQEETVKKLSMAAREERIRESRQQG
QLKEKRLKNPDSKGDTSHDKPTRETWKPLAVEDLPKDEDPDEFGIPEVYKCGNCLVGFAP
VKKKKLMFVTLTERCLELHESEKSYRAGKAAKHMVDLSMSFNVHSEHYDAKLKKCLCLMG
PDETICMRPEGGILTIEGWRRAIVKLIHESRRRKMDRVPRPEDIFDAAYDVRVCLFPKNL
EKYVESLKTDGFTNICTVAKELLGKKRLCLYPNTLAIVDLCIEPTAYGLPPAGFPPFRAS
SMFILERNTVAYYGFRENYFYVRIGKGSPYRGFELLFQVDTNEVCKEIYSRLRALADRDL
ENRKQESIRRPERPRVSTLQSVKPGKEETGLREALLESYGHLRKKNSTQSERGEIVVPEQ
ERKMSDNRPRLRTQDIKTVTKPELKSEEPIRPRLPPLKFNANKPSGEFLLSLQREKELME
EARKNGYDGRTHNPDGTPREIKKDFLDTVCPQAAAPEVVIKEKIINNDTYTLMGPADWGK
LEDIVKDDYSDSGDSCYSSRRGTGSQPTRPAASHLACQMQNRTQSFGAKQQTFQNRLPPT
VNLPDSERKISAANQGTSNQLDLPQEDPRKRAFSLGSKNFFNLIGLNDFRRLVSKRHRTS
SPNHTSTSGISLNSSNASPSASSNFLASSEYLEHARTDSFGSARSSPKSLHTQRTSSPKR
RSDEDLISIDFSRLGKNSASDTKRFPFGGGGPGGSFDYDREKREKEDNNRRDREKAAMDL
KRKEEWEARELAEKKRELERKIQAKKDRKLEKGRGKDREKDKDHDHDKEFRPKADSGIAD
CTPSSSFSGKKDHKNDGSSDSAYMDKEGLKYLADIKKRKKEQGAIDTTNSSSSSLSTIVS
IEDNKVTRRITETVETKVVTADLAKALGAIDPNRRSSACIEINRKPSICTAIMEEREGEA
SETDSRGEPSDRKTTAAPVTRKPASTGSSMSPFRRLKFLSFRK
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccgccgagcctacatctggtgaaccgaaaaatgacggagagtacgttgagaca
atgtttgacgccacggaagagaagaaacaagaaacgattgcgccaaaacaggaagaaact
gtaaagaaattatcaatggcagcaagagaggagagaatacgcgaaagtagacaacaaggg
caactgaaagaaaaaaggctgaaaaatccagattcaaaaggtgatacaagtcacgataag
ccgaccagagaaacatggaagccgttagccgttgaagacttaccaaaggatgaagatccg
gatgaatttggaattccagaagtctacaaatgtggaaattgtttagtagggtttgctcca
gtgaaaaagaaaaagctaatgtttgtgacactcacggaacgatgtttagaacttcacgag
tcggagaaatcctatcgtgcgggaaaagcagcaaagcatatggtagatctctcaatgtct
tttaatgtgcacagtgagcattacgatgcaaaactaaagaaatgcctatgcttgatgggt
ccagacgaaacaatatgcatgagaccggaaggaggaattctaaccattgaaggttggcga
cgagcaattgtaaaactaattcatgaatcaagaagaagaaaaatggaccgcgttccgaga
cctgaagatatttttgatgctgcatatgatgtacgtgtttgtctatttccaaaaaacttg
gaaaaatacgtggaaagcttgaaaacagacgggttcacaaacatatgtactgttgccaaa
gagcttttaggaaagaaaagattatgcctttatccaaatacacttgccattgttgatctc
tgcattgaaccaactgcctatggtctcccacctgccgggtttcccccattccgtgcatca
agcatgttcattttggagcgaaatacggttgcttactacggttttcgtgaaaactatttc
tatgtacgaattggaaagggaagcccctatcgagggtttgagttattgttccaagtggac
actaacgaagtttgtaaggaaatttactcacgtcttagagcactcgctgatcgtgatctt
gaaaaccggaaacaagaatctatacggagaccagaaagaccccgtgtttctactcttcaa
agtgtgaaaccgggcaaagaagaaaccggactacgtgaagcacttcttgaatcatatggc
catttaagaaaaaagaattcaacacaatcagagcgaggagagatagttgttccggagcaa
gaacggaaaatgtcagacaacaggcctcggctcagaactcaggatataaaaactgttaca
aagcctgaactgaaatcagaagaacctatacgcccgagacttccaccgctaaaattcaat
gctaacaaaccgtctggagaatttttattatcgctccaacgggagaaagagttaatggaa
gaggcaagaaaaaatggttatgatggaagaacacacaatcctgatgggactcctcgagaa
atcaaaaaagatttcctcgacactgtttgtccacaagctgcagcgccagaagttgtgatc
aaagagaaaatcataaacaacgatacttatacgctgatgggtccagccgactggggaaaa
ctggaagatattgtcaaagatgattactcggacagtggggacagttgttattcatcaaga
agaggaaccggtagtcaaccgacccgaccggccgcttctcacctcgcatgtcaaatgcaa
aaccgaacacagtcatttggagctaaacaacaaacatttcaaaaccgacttccgcctact
gtaaatctgcctgattctgaaagaaaaatttcggctgccaaccaaggaacgtcaaaccaa
ctcgaccttccacaagaagatccaagaaaaagagcattctcattgggaagtaaaaacttt
ttcaacctgataggattgaatgactttcgtcgccttgtaagcaagcgtcatcgaacatca
tctccaaaccacacctctacttctggtatctcgttaaactcatctaacgcatccccgtca
gcaagtagtaattttttggcttcttctgaatatttagaacatgcaagaactgatagtttt
gggtccgcaagaagtagtccaaaaagtctacacacccagcgaaccagttcaccgaaaaga
agatcggacgaggatctgatctcaattgacttttcaagattaggtaaaaattctgcatca
gatacaaaacgatttccttttggtggaggaggaccaggagggtcctttgattatgataga
gaaaaacgggaaaaggaagataataatagacgagaccgagaaaaagcagcaatggatttg
aaaagaaaagaagaatgggaagcgagagaattagcggaaaagaagagggagttggaacgg
aaaattcaagcaaagaaagatagaaaattggagaagggaagagggaaagatagagaaaag
gataaagaccacgatcatgataaggagtttcgtccaaaagcggacagtggaattgctgat
tgtacgcccagttcaagtttttctgggaagaaagatcacaaaaatgatggttcttctgat
tctgcatacatggacaaagaagggttgaagtacttggcagatatcaaaaaacggaaaaaa
gagcaaggtgccatagacacaacaaattcctcctcctcctcgttaagcacaatagtttcg
attgaagataacaaagtgaccagaagaatcacggaaaccgttgaaacaaaagttgtgact
gcggatctagcgaaagcacttggtgcaattgacccgaatagaagatcttcagcatgcatt
gagataaatcgaaaaccatcgatttgtacagcaataatggaagaaagagaaggagaagca
tctgagaccgattctaggggagaaccatccgacaggaagacgaccgcggcccctgtaact
cggaaacctgcatcgactggcagcagcatgagcccgttcagaagacttaaatttctcagc
ttcagaaaataa

DBGET integrated database retrieval system