KEGG   Caenorhabditis elegans (nematode): CELE_D2063.1Help
Entry
CELE_D2063.1      CDS       T00019                                 

Definition
Protein D2063.1
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CELE_D2063.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_D2063.1
  Lipid metabolism
   00071 Fatty acid degradation
    CELE_D2063.1
  Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_D2063.1
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_D2063.1
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_D2063.1
   00982 Drug metabolism - cytochrome P450
    CELE_D2063.1
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CELE_D2063.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V:join(4327146..4327430,4327479..4327800,4327873..4328027,4328518..4328736)
Genome map
AA seq 326 aa AA seqDB search
MVSSDVPKTQRALIFESYGGPLEIKQLPIPQPNEDELLVKMEYSGICHSDVHTWLGDFHY
VSKCPMIGGHEGAGSVISVGSKVKNWQIGDKVGIKLVQGNCLNCEYCQTGHEPLCPHVWN
IGVQKYGTFQEYATIRDVDAIKIPKSMNMAAAAPVLCGGVTAYKALKESEVKSGQIVAVT
GAGGGLGSFAIQYARAMGMRVVAEDIVAHIREITDGGAHGVVNFAAAKVPMEKALEYVRK
RGTVVFVGLAKDSKILVDTIPLIFNAVKIKGSIVGSRLDVNEAMDFVARGAVNVPLELVK
LEDVAEVYTKMHDGKINSRVVVDFSL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatctgatgttccaaagactcaacgcgctcttatttttgaatcatacggaggt
ccacttgaaatcaagcaacttccgattcctcaacccaatgaggatgaacttttggtgaaa
atggaatattctggaatatgccattcggatgttcatacgtggctaggtgactttcattat
gtttccaaatgtccaatgattggtgggcatgaaggcgccggcagtgtgatcagcgttgga
tcgaaagtaaaaaattggcaaatcggagataaagttgggattaagttggtccaaggaaac
tgccttaactgtgagtattgccaaactggacatgaaccactttgccctcatgtctggaac
attggagttcaaaaatatggaaccttccaagagtacgctactattcgtgacgttgatgct
atcaaaatcccaaagagtatgaatatggccgccgctgctcccgtgctttgtggtggtgta
actgcgtataaagccctaaaggagtctgaagtgaagtctggacaaattgttgcagtcact
ggagctggtggtgggctgggatcttttgcaattcaatacgcaagagctatgggaatgcga
gttgttgctgaggatattgtggcacacattcgagaaattactgatggtggagcacatggt
gttgtcaattttgcagctgctaaggtgcccatggagaaggctctagagtacgttagaaaa
cgaggaactgtggtgtttgtaggacttgcgaaagactcaaagattctcgtcgacacaatc
cccctgattttcaacgctgtaaaaatcaaaggatcaattgttggatcccgattggatgtc
aatgaggctatggattttgtggctcgtggagccgtcaatgtcccattagagttggtgaag
ctggaagacgtcgccgaagtctacacaaaaatgcacgatggaaagataaattctcgggtt
gttgtggatttctctttgtaa

DBGET integrated database retrieval system